Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 312693..312908 | Replicon | chromosome |
Accession | NZ_CP037835 | ||
Organism | Clostridioides difficile strain Cd7 |
Toxin (Protein)
Gene name | CD0977.1 | Uniprot ID | Q18AH6 |
Locus tag | E1H30_RS01910 | Protein ID | WP_011861054.1 |
Coordinates | 312693..312836 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd11 | ||
Locus tag | - | ||
Coordinates | 312758..312908 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1H30_RS01885 (308364) | 308364..308711 | + | 348 | WP_009898409.1 | hypothetical protein | - |
E1H30_RS01890 (308877) | 308877..309395 | + | 519 | WP_009898407.1 | DUF5706 domain-containing protein | - |
E1H30_RS01895 (309459) | 309459..311027 | - | 1569 | WP_009898404.1 | hypothetical protein | - |
E1H30_RS01900 (311021) | 311021..311542 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
E1H30_RS01905 (312244) | 312244..312432 | - | 189 | WP_021358766.1 | hypothetical protein | - |
E1H30_RS01910 (312693) | 312693..312836 | + | 144 | WP_011861054.1 | hypothetical protein | Toxin |
- (312758) | 312758..312908 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312758) | 312758..312908 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312758) | 312758..312908 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312762) | 312762..312908 | - | 147 | NuclAT_1 | - | - |
E1H30_RS01915 (313041) | 313041..313217 | - | 177 | WP_021358767.1 | hypothetical protein | - |
E1H30_RS01920 (313580) | 313580..313969 | + | 390 | WP_021393943.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H30_RS01925 (314063) | 314063..314446 | + | 384 | WP_021358769.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H30_RS01930 (315164) | 315164..316555 | + | 1392 | WP_021393934.1 | metallophosphoesterase | - |
E1H30_RS01935 (316703) | 316703..317011 | - | 309 | WP_021395947.1 | LysR substrate-binding domain-containing protein | - |
E1H30_RS01940 (317048) | 317048..317569 | + | 522 | WP_021358772.1 | chromate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5337.27 Da Isoelectric Point: 10.5719
>T120150 WP_011861054.1 NZ_CP037835:312693-312836 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
Download Length: 144 bp
>T120150 NZ_CP037835:312693-312836 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
Antitoxin
Download Length: 151 bp
>AT120150 NZ_CP037835:c312908-312758 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|