Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 312963..313178 | Replicon | chromosome |
Accession | NZ_CP037827 | ||
Organism | Clostridioides difficile strain Cd10 |
Toxin (Protein)
Gene name | CD0977.1 | Uniprot ID | Q18AH6 |
Locus tag | E1H33_RS01920 | Protein ID | WP_011861054.1 |
Coordinates | 312963..313106 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd11 | ||
Locus tag | - | ||
Coordinates | 313028..313178 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1H33_RS01895 (308634) | 308634..308981 | + | 348 | WP_009898409.1 | hypothetical protein | - |
E1H33_RS01900 (309147) | 309147..309665 | + | 519 | WP_009898407.1 | DUF5706 domain-containing protein | - |
E1H33_RS01905 (309729) | 309729..311315 | - | 1587 | WP_015984865.1 | hypothetical protein | - |
E1H33_RS01910 (311291) | 311291..311812 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
E1H33_RS01915 (312514) | 312514..312702 | - | 189 | WP_021358766.1 | hypothetical protein | - |
E1H33_RS01920 (312963) | 312963..313106 | + | 144 | WP_011861054.1 | hypothetical protein | Toxin |
- (313028) | 313028..313178 | - | 151 | NuclAT_0 | - | Antitoxin |
- (313028) | 313028..313178 | - | 151 | NuclAT_0 | - | Antitoxin |
- (313028) | 313028..313178 | - | 151 | NuclAT_0 | - | Antitoxin |
- (313032) | 313032..313178 | - | 147 | NuclAT_1 | - | - |
E1H33_RS01925 (313311) | 313311..313487 | - | 177 | WP_021358767.1 | hypothetical protein | - |
E1H33_RS01930 (313850) | 313850..314239 | + | 390 | WP_021393943.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H33_RS01935 (314333) | 314333..314716 | + | 384 | WP_021358769.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H33_RS01940 (315434) | 315434..316825 | + | 1392 | WP_021393934.1 | metallophosphoesterase | - |
E1H33_RS01945 (316973) | 316973..317281 | - | 309 | WP_021395947.1 | LysR substrate-binding domain-containing protein | - |
E1H33_RS01950 (317318) | 317318..317839 | + | 522 | WP_021358772.1 | chromate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5337.27 Da Isoelectric Point: 10.5719
>T120112 WP_011861054.1 NZ_CP037827:312963-313106 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
Download Length: 144 bp
>T120112 NZ_CP037827:312963-313106 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
Antitoxin
Download Length: 151 bp
>AT120112 NZ_CP037827:c313178-313028 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|