Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2063196..2063392 | Replicon | chromosome |
Accession | NZ_CP037811 | ||
Organism | Clostridioides difficile strain Cd17 |
Toxin (Protein)
Gene name | CD1418.2 | Uniprot ID | D5Q3X5 |
Locus tag | E1H40_RS09765 | Protein ID | WP_003424190.1 |
Coordinates | 2063240..2063392 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | CD630_n00500 | ||
Locus tag | - | ||
Coordinates | 2063196..2063296 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1H40_RS18420 (2058216) | 2058216..2058350 | - | 135 | WP_003424178.1 | hypothetical protein | - |
E1H40_RS09745 (2058356) | 2058356..2058715 | - | 360 | WP_009905664.1 | hypothetical protein | - |
E1H40_RS09750 (2058729) | 2058729..2058986 | - | 258 | WP_003424182.1 | hypothetical protein | - |
E1H40_RS09755 (2058973) | 2058973..2059206 | - | 234 | WP_003424184.1 | hypothetical protein | - |
E1H40_RS09760 (2059392) | 2059392..2059580 | + | 189 | WP_003424185.1 | helix-turn-helix transcriptional regulator | - |
E1H40_RS18425 (2059783) | 2059783..2059914 | - | 132 | WP_003424186.1 | hypothetical protein | - |
- (2063196) | 2063196..2063296 | + | 101 | NuclAT_0 | - | Antitoxin |
- (2063196) | 2063196..2063296 | + | 101 | NuclAT_0 | - | Antitoxin |
- (2063196) | 2063196..2063296 | + | 101 | NuclAT_0 | - | Antitoxin |
E1H40_RS09765 (2063240) | 2063240..2063392 | - | 153 | WP_003424190.1 | hypothetical protein | Toxin |
E1H40_RS09770 (2063912) | 2063912..2064154 | + | 243 | WP_003424191.1 | hypothetical protein | - |
E1H40_RS09775 (2064235) | 2064235..2064765 | + | 531 | WP_003424192.1 | site-specific integrase | - |
E1H40_RS09780 (2065309) | 2065309..2066154 | + | 846 | WP_003424194.1 | DUF4878 domain-containing protein | - |
E1H40_RS09785 (2066378) | 2066378..2066542 | - | 165 | WP_003424195.1 | hypothetical protein | - |
E1H40_RS18190 (2067074) | 2067074..2067265 | - | 192 | WP_003424196.1 | carboxymuconolactone decarboxylase family protein | - |
E1H40_RS18195 (2067265) | 2067265..2067405 | - | 141 | WP_003424197.1 | hypothetical protein | - |
E1H40_RS09795 (2067664) | 2067664..2068305 | - | 642 | WP_003424198.1 | SdpI family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5744.78 Da Isoelectric Point: 10.6276
>T120054 WP_003424190.1 NZ_CP037811:c2063392-2063240 [Clostridioides difficile]
MDNFLQGILASLVASLIVYLTSKLFKKVKSHSGRSDFSFELEIKFKKNKH
MDNFLQGILASLVASLIVYLTSKLFKKVKSHSGRSDFSFELEIKFKKNKH
Download Length: 153 bp
>T120054 NZ_CP037811:c2063392-2063240 [Clostridioides difficile]
ATGGATAATTTTTTACAAGGTATATTAGCAAGTTTAGTTGCCAGTTTAATAGTTTACTTAACTAGTAAGTTATTTAAAAA
AGTAAAAAGCCACTCTGGCAGGAGTGACTTTAGTTTTGAACTAGAAATCAAGTTCAAAAAGAATAAACATTAG
ATGGATAATTTTTTACAAGGTATATTAGCAAGTTTAGTTGCCAGTTTAATAGTTTACTTAACTAGTAAGTTATTTAAAAA
AGTAAAAAGCCACTCTGGCAGGAGTGACTTTAGTTTTGAACTAGAAATCAAGTTCAAAAAGAATAAACATTAG
Antitoxin
Download Length: 101 bp
>AT120054 NZ_CP037811:2063196-2063296 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTCTAGTTC
AAAACTAAAGTCACTCCTGCC
AAGAAGAACTACAATCTATTTAGACGTAGAGTGAAGTTCAAATACTAATGTTTATTCTTTTTGAACTTGATTTCTAGTTC
AAAACTAAAGTCACTCCTGCC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|