Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 173202..173382 | Replicon | chromosome |
| Accession | NZ_CP035791 | ||
| Organism | Staphylococcus aureus strain 592 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ERW13_RS01130 | Protein ID | WP_001801861.1 |
| Coordinates | 173287..173382 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 173202..173259 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ERW13_RS01100 | 168911..169045 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| ERW13_RS01105 | 169209..170765 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| ERW13_RS01110 | 170758..171987 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| ERW13_RS01115 | 172439..172933 | + | 495 | Protein_175 | transposase | - |
| ERW13_RS01120 | 172924..173085 | + | 162 | Protein_176 | transposase | - |
| ERW13_RS01125 | 173063..173164 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 173202..173259 | + | 58 | - | - | Antitoxin |
| ERW13_RS01130 | 173287..173382 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| ERW13_RS01135 | 173527..174539 | + | 1013 | Protein_179 | IS3 family transposase | - |
| ERW13_RS01140 | 174737..175309 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| ERW13_RS01145 | 175410..175751 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| ERW13_RS01150 | 175792..176418 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| ERW13_RS01155 | 176493..177488 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| ERW13_RS01160 | 177569..178219 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 146369..178977 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T118514 WP_001801861.1 NZ_CP035791:c173382-173287 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T118514 NZ_CP035791:c173382-173287 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT118514 NZ_CP035791:173202-173259 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|