117627

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2137879..2138104 Replicon chromosome
Accession NZ_CP035366
Organism Escherichia coli O157:H7 strain C1-057

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag ES669_RS10985 Protein ID WP_000813258.1
Coordinates 2137879..2138034 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2138046..2138104 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ES669_RS10935 2132882..2133313 - 432 WP_001302123.1 tellurite resistance protein -
ES669_RS10950 2133764..2134477 - 714 WP_000301797.1 helix-turn-helix domain-containing protein -
ES669_RS10955 2134613..2134810 - 198 WP_000917763.1 hypothetical protein -
ES669_RS10960 2135035..2135589 - 555 WP_000640035.1 DUF1133 family protein -
ES669_RS10965 2135652..2135957 - 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
ES669_RS10970 2135970..2137019 - 1050 WP_001265229.1 DUF968 domain-containing protein -
ES669_RS10975 2137021..2137293 - 273 WP_000191872.1 hypothetical protein -
ES669_RS10980 2137415..2137759 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
ES669_RS10985 2137879..2138034 - 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
- 2138046..2138104 + 59 - - Antitoxin
ES669_RS10990 2138325..2138882 - 558 WP_000104474.1 DUF551 domain-containing protein -
ES669_RS10995 2138884..2139102 - 219 WP_000683609.1 DUF4014 family protein -
ES669_RS11000 2139230..2139541 - 312 WP_001289673.1 hypothetical protein -
ES669_RS11005 2139534..2139761 - 228 WP_000699809.1 hypothetical protein -
ES669_RS11010 2139758..2140039 - 282 WP_000603384.1 DNA-binding protein -
ES669_RS11015 2140072..2140788 - 717 WP_000450627.1 DUF1627 domain-containing protein -
ES669_RS11020 2140822..2141283 - 462 WP_000139447.1 replication protein -
ES669_RS11025 2141276..2142319 - 1044 WP_001262402.1 hypothetical protein -
ES669_RS11030 2142388..2142813 - 426 WP_000693878.1 Rha family transcriptional regulator -
ES669_RS11035 2142797..2143039 - 243 WP_000747948.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2100765..2198697 97932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T117627 WP_000813258.1 NZ_CP035366:c2138034-2137879 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T117627 NZ_CP035366:c2138034-2137879 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT117627 NZ_CP035366:2138046-2138104 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References