Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1851055..1851237 | Replicon | chromosome |
Accession | NZ_CP035101 | ||
Organism | Staphylococcus aureus strain ATCC 12600 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EQG65_RS09165 | Protein ID | WP_001801861.1 |
Coordinates | 1851055..1851150 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1851178..1851237 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQG65_RS09115 | 1846715..1847341 | + | 627 | WP_000669046.1 | hypothetical protein | - |
EQG65_RS09120 | 1847382..1847726 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EQG65_RS09125 | 1847824..1848375 | + | 552 | WP_000414205.1 | hypothetical protein | - |
EQG65_RS09130 | 1848593..1849234 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EQG65_RS09135 | 1849348..1849533 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EQG65_RS09140 | 1849535..1849711 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EQG65_RS09145 | 1849722..1850105 | - | 384 | WP_000070812.1 | hypothetical protein | - |
EQG65_RS09155 | 1850709..1850852 | - | 144 | WP_001549059.1 | transposase | - |
EQG65_RS09165 | 1851055..1851150 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1851178..1851237 | - | 60 | - | - | Antitoxin |
EQG65_RS09170 | 1851273..1851374 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EQG65_RS09175 | 1851352..1851528 | - | 177 | Protein_1767 | transposase | - |
EQG65_RS09180 | 1851722..1852099 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1844155..1884326 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T117191 WP_001801861.1 NZ_CP035101:1851055-1851150 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T117191 NZ_CP035101:1851055-1851150 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT117191 NZ_CP035101:c1851237-1851178 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|