Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1891372..1891552 | Replicon | chromosome |
Accession | NZ_CP034008 | ||
Organism | Staphylococcus aureus strain P1D5C2 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EFD69_RS09105 | Protein ID | WP_001801861.1 |
Coordinates | 1891372..1891467 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1891495..1891552 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFD69_RS09075 | 1886535..1887185 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
EFD69_RS09080 | 1887266..1888261 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
EFD69_RS09085 | 1888336..1888962 | + | 627 | WP_000669024.1 | hypothetical protein | - |
EFD69_RS09090 | 1889003..1889344 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
EFD69_RS09095 | 1889445..1890017 | + | 573 | WP_000414216.1 | hypothetical protein | - |
EFD69_RS09100 | 1890215..1891227 | - | 1013 | Protein_1774 | IS3 family transposase | - |
EFD69_RS09105 | 1891372..1891467 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1891495..1891552 | - | 58 | - | - | Antitoxin |
EFD69_RS09110 | 1891590..1891691 | + | 102 | WP_001792025.1 | hypothetical protein | - |
EFD69_RS09115 | 1891669..1891830 | - | 162 | Protein_1777 | transposase | - |
EFD69_RS09120 | 1891821..1892315 | - | 495 | Protein_1778 | transposase | - |
EFD69_RS09125 | 1892767..1893996 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
EFD69_RS09130 | 1893989..1895545 | - | 1557 | WP_064135920.1 | type I restriction-modification system subunit M | - |
EFD69_RS09135 | 1895709..1895843 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1885777..1920178 | 34401 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T114908 WP_001801861.1 NZ_CP034008:1891372-1891467 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T114908 NZ_CP034008:1891372-1891467 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT114908 NZ_CP034008:c1891552-1891495 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|