Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1891179..1891359 | Replicon | chromosome |
| Accession | NZ_CP033990 | ||
| Organism | Staphylococcus aureus strain P1D14C1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EFD75_RS09105 | Protein ID | WP_001801861.1 |
| Coordinates | 1891179..1891274 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1891302..1891359 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFD75_RS09075 | 1886342..1886992 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| EFD75_RS09080 | 1887073..1888068 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| EFD75_RS09085 | 1888143..1888769 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| EFD75_RS09090 | 1888810..1889151 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| EFD75_RS09095 | 1889252..1889824 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| EFD75_RS09100 | 1890022..1891034 | - | 1013 | Protein_1774 | IS3 family transposase | - |
| EFD75_RS09105 | 1891179..1891274 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1891302..1891359 | - | 58 | - | - | Antitoxin |
| EFD75_RS09110 | 1891397..1891498 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| EFD75_RS09115 | 1891476..1891637 | - | 162 | Protein_1777 | transposase | - |
| EFD75_RS09120 | 1891628..1892122 | - | 495 | Protein_1778 | transposase | - |
| EFD75_RS09125 | 1892574..1893803 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| EFD75_RS09130 | 1893796..1895352 | - | 1557 | WP_064135920.1 | type I restriction-modification system subunit M | - |
| EFD75_RS09135 | 1895516..1895650 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1883947..1919985 | 36038 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T114818 WP_001801861.1 NZ_CP033990:1891179-1891274 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T114818 NZ_CP033990:1891179-1891274 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT114818 NZ_CP033990:c1891359-1891302 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|