Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1937922..1938102 | Replicon | chromosome |
Accession | NZ_CP033987 | ||
Organism | Staphylococcus aureus strain P2D1C1 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EFD76_RS09515 | Protein ID | WP_001801861.1 |
Coordinates | 1937922..1938017 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1938045..1938102 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFD76_RS09485 | 1933085..1933735 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
EFD76_RS09490 | 1933816..1934811 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
EFD76_RS09495 | 1934886..1935512 | + | 627 | WP_000669024.1 | hypothetical protein | - |
EFD76_RS09500 | 1935553..1935894 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
EFD76_RS09505 | 1935995..1936567 | + | 573 | WP_000414216.1 | hypothetical protein | - |
EFD76_RS09510 | 1936765..1937777 | - | 1013 | Protein_1829 | IS3 family transposase | - |
EFD76_RS09515 | 1937922..1938017 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1938045..1938102 | - | 58 | - | - | Antitoxin |
EFD76_RS09520 | 1938140..1938241 | + | 102 | WP_001792025.1 | hypothetical protein | - |
EFD76_RS09525 | 1938219..1938380 | - | 162 | Protein_1832 | transposase | - |
EFD76_RS09530 | 1938371..1938865 | - | 495 | Protein_1833 | transposase | - |
EFD76_RS09535 | 1939317..1940546 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
EFD76_RS09540 | 1940539..1942095 | - | 1557 | WP_064135920.1 | type I restriction-modification system subunit M | - |
EFD76_RS09545 | 1942259..1942393 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1932327..1964059 | 31732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T114800 WP_001801861.1 NZ_CP033987:1937922-1938017 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T114800 NZ_CP033987:1937922-1938017 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT114800 NZ_CP033987:c1938102-1938045 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|