Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1898440..1898620 | Replicon | chromosome |
| Accession | NZ_CP031779 | ||
| Organism | Staphylococcus aureus strain CFBR-105 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | D1F65_RS09490 | Protein ID | WP_001801861.1 |
| Coordinates | 1898440..1898535 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1898563..1898620 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1F65_RS09460 | 1893603..1894253 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| D1F65_RS09465 | 1894334..1895329 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| D1F65_RS09470 | 1895404..1896030 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| D1F65_RS09475 | 1896071..1896412 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| D1F65_RS09480 | 1896513..1897085 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| D1F65_RS09485 | 1897283..1898295 | - | 1013 | Protein_1779 | IS3 family transposase | - |
| D1F65_RS09490 | 1898440..1898535 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1898563..1898620 | - | 58 | - | - | Antitoxin |
| D1F65_RS09495 | 1898658..1898759 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| D1F65_RS09500 | 1898737..1898898 | - | 162 | Protein_1782 | transposase | - |
| D1F65_RS09505 | 1898889..1899383 | - | 495 | Protein_1783 | transposase | - |
| D1F65_RS09510 | 1899835..1901064 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| D1F65_RS09515 | 1901057..1902613 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| D1F65_RS09520 | 1902777..1902911 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1892844..1925453 | 32609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T110030 WP_001801861.1 NZ_CP031779:1898440-1898535 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T110030 NZ_CP031779:1898440-1898535 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT110030 NZ_CP031779:c1898620-1898563 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|