Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1847449..1847631 | Replicon | chromosome |
Accession | NZ_CP031664 | ||
Organism | Staphylococcus aureus strain 28 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DD545_RS09320 | Protein ID | WP_001801861.1 |
Coordinates | 1847449..1847544 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1847572..1847631 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD545_RS09270 | 1843109..1843735 | + | 627 | WP_000669046.1 | hypothetical protein | - |
DD545_RS09275 | 1843776..1844120 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
DD545_RS09280 | 1844218..1844769 | + | 552 | WP_000414205.1 | hypothetical protein | - |
DD545_RS09285 | 1844987..1845628 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DD545_RS09290 | 1845742..1845927 | - | 186 | WP_000809857.1 | hypothetical protein | - |
DD545_RS09295 | 1845929..1846105 | - | 177 | WP_000375476.1 | hypothetical protein | - |
DD545_RS09300 | 1846116..1846499 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DD545_RS09310 | 1847103..1847246 | - | 144 | WP_001549059.1 | transposase | - |
DD545_RS09320 | 1847449..1847544 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1847572..1847631 | - | 60 | - | - | Antitoxin |
DD545_RS09325 | 1847667..1847768 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DD545_RS09330 | 1847746..1847922 | - | 177 | Protein_1758 | transposase | - |
DD545_RS09335 | 1848116..1848493 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1840549..1880719 | 40170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T109684 WP_001801861.1 NZ_CP031664:1847449-1847544 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T109684 NZ_CP031664:1847449-1847544 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT109684 NZ_CP031664:c1847631-1847572 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|