Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1830232..1830414 | Replicon | chromosome |
Accession | NZ_CP031265 | ||
Organism | Staphylococcus aureus strain 13 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DWB87_RS09095 | Protein ID | WP_001801861.1 |
Coordinates | 1830232..1830327 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1830355..1830414 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DWB87_RS09045 | 1825902..1826528 | + | 627 | WP_000669017.1 | hypothetical protein | - |
DWB87_RS09050 | 1826569..1826910 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
DWB87_RS09055 | 1827011..1827583 | + | 573 | WP_000414202.1 | hypothetical protein | - |
DWB87_RS09060 | 1827781..1828338 | - | 558 | Protein_1736 | ImmA/IrrE family metallo-endopeptidase | - |
DWB87_RS09065 | 1828524..1828694 | - | 171 | WP_169301139.1 | hypothetical protein | - |
DWB87_RS09070 | 1828712..1828888 | - | 177 | WP_000375477.1 | hypothetical protein | - |
DWB87_RS09075 | 1828899..1829282 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DWB87_RS09085 | 1829886..1830029 | - | 144 | WP_001549059.1 | transposase | - |
DWB87_RS09095 | 1830232..1830327 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1830355..1830414 | - | 60 | - | - | Antitoxin |
DWB87_RS09100 | 1830450..1830551 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DWB87_RS09105 | 1830529..1830705 | - | 177 | Protein_1743 | transposase | - |
DWB87_RS09110 | 1830899..1831276 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1823512..1863510 | 39998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T108794 WP_001801861.1 NZ_CP031265:1830232-1830327 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T108794 NZ_CP031265:1830232-1830327 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT108794 NZ_CP031265:c1830414-1830355 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|