Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1978900..1979080 | Replicon | chromosome |
| Accession | NZ_CP030326 | ||
| Organism | Staphylococcus aureus strain AR_474 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSC59_RS10325 | Protein ID | WP_001801861.1 |
| Coordinates | 1978900..1978995 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1979023..1979080 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC59_RS10295 | 1974063..1974713 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| CSC59_RS10300 | 1974794..1975789 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| CSC59_RS10305 | 1975864..1976490 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| CSC59_RS10310 | 1976531..1976872 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| CSC59_RS10315 | 1976973..1977545 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| CSC59_RS10320 | 1977743..1978755 | - | 1013 | Protein_1909 | IS3 family transposase | - |
| CSC59_RS10325 | 1978900..1978995 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1979023..1979080 | - | 58 | - | - | Antitoxin |
| CSC59_RS10330 | 1979118..1979219 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| CSC59_RS10335 | 1979197..1979358 | - | 162 | Protein_1912 | transposase | - |
| CSC59_RS10340 | 1979349..1979843 | - | 495 | Protein_1913 | transposase | - |
| CSC59_RS10345 | 1980295..1981524 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| CSC59_RS10350 | 1981517..1983073 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| CSC59_RS10355 | 1983237..1983371 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1973304..2005036 | 31732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T107693 WP_001801861.1 NZ_CP030326:1978900-1978995 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T107693 NZ_CP030326:1978900-1978995 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT107693 NZ_CP030326:c1979080-1979023 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|