Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 559936..560116 | Replicon | chromosome |
Accession | NZ_CP029680 | ||
Organism | Staphylococcus aureus strain AR_0215 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSB71_RS03480 | Protein ID | WP_001801861.1 |
Coordinates | 560021..560116 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 559936..559993 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB71_RS03450 | 555645..555779 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CSB71_RS03455 | 555943..557499 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSB71_RS03460 | 557492..558721 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSB71_RS03465 | 559173..559667 | + | 495 | Protein_577 | transposase | - |
CSB71_RS03470 | 559658..559819 | + | 162 | Protein_578 | transposase | - |
CSB71_RS03475 | 559797..559898 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 559936..559993 | + | 58 | - | - | Antitoxin |
CSB71_RS03480 | 560021..560116 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSB71_RS03485 | 560261..561273 | + | 1013 | Protein_581 | IS3 family transposase | - |
CSB71_RS03490 | 561471..562043 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CSB71_RS03495 | 562144..562485 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSB71_RS03500 | 562526..563152 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CSB71_RS03505 | 563227..564222 | - | 996 | WP_110179682.1 | DUF4352 domain-containing protein | - |
CSB71_RS03510 | 564303..564953 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 533103..565712 | 32609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106314 WP_001801861.1 NZ_CP029680:c560116-560021 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106314 NZ_CP029680:c560116-560021 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106314 NZ_CP029680:559936-559993 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|