Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1977493..1977675 | Replicon | chromosome |
| Accession | NZ_CP029678 | ||
| Organism | Staphylococcus aureus strain AR_0216 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSB72_RS10380 | Protein ID | WP_001801861.1 |
| Coordinates | 1977493..1977588 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1977616..1977675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSB72_RS10330 | 1973153..1973779 | + | 627 | Protein_1909 | hypothetical protein | - |
| CSB72_RS10335 | 1973820..1974164 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| CSB72_RS10340 | 1974262..1974813 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| CSB72_RS10345 | 1975031..1975672 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CSB72_RS10350 | 1975786..1975971 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| CSB72_RS10355 | 1975973..1976149 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| CSB72_RS10360 | 1976160..1976543 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| CSB72_RS10370 | 1977147..1977290 | - | 144 | WP_001549059.1 | transposase | - |
| CSB72_RS10380 | 1977493..1977588 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1977616..1977675 | - | 60 | - | - | Antitoxin |
| CSB72_RS10385 | 1977711..1977812 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| CSB72_RS10390 | 1977790..1977966 | - | 177 | Protein_1919 | transposase | - |
| CSB72_RS10395 | 1978160..1978537 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1970593..2010764 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106287 WP_001801861.1 NZ_CP029678:1977493-1977588 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106287 NZ_CP029678:1977493-1977588 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT106287 NZ_CP029678:c1977675-1977616 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|