Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1933741..1933921 | Replicon | chromosome |
Accession | NZ_CP029675 | ||
Organism | Staphylococcus aureus strain AR_0219 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSB75_RS09965 | Protein ID | WP_001801861.1 |
Coordinates | 1933741..1933836 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1933864..1933921 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB75_RS09935 | 1928904..1929554 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
CSB75_RS09940 | 1929635..1930630 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSB75_RS09945 | 1930705..1931331 | + | 627 | WP_000669024.1 | hypothetical protein | - |
CSB75_RS09950 | 1931372..1931713 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSB75_RS09955 | 1931814..1932386 | + | 573 | WP_000414216.1 | hypothetical protein | - |
CSB75_RS09960 | 1932584..1933596 | - | 1013 | Protein_1839 | IS3 family transposase | - |
CSB75_RS09965 | 1933741..1933836 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1933864..1933921 | - | 58 | - | - | Antitoxin |
CSB75_RS09970 | 1933959..1934060 | + | 102 | WP_001792025.1 | hypothetical protein | - |
CSB75_RS09975 | 1934038..1934199 | - | 162 | Protein_1842 | transposase | - |
CSB75_RS09980 | 1934190..1934684 | - | 495 | Protein_1843 | transposase | - |
CSB75_RS09985 | 1935136..1936365 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
CSB75_RS09990 | 1936358..1937914 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSB75_RS09995 | 1938078..1938212 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1928146..1960753 | 32607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106271 WP_001801861.1 NZ_CP029675:1933741-1933836 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106271 NZ_CP029675:1933741-1933836 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106271 NZ_CP029675:c1933921-1933864 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|