Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1900925..1901105 | Replicon | chromosome |
| Accession | NZ_CP029673 | ||
| Organism | Staphylococcus aureus strain AR_0220 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSB76_RS09665 | Protein ID | WP_001801861.1 |
| Coordinates | 1900925..1901020 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1901048..1901105 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSB76_RS09635 | 1896088..1896738 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| CSB76_RS09640 | 1896819..1897814 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| CSB76_RS09645 | 1897889..1898515 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| CSB76_RS09650 | 1898556..1898897 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| CSB76_RS09655 | 1898998..1899570 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| CSB76_RS09660 | 1899768..1900780 | - | 1013 | Protein_1779 | IS3 family transposase | - |
| CSB76_RS09665 | 1900925..1901020 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1901048..1901105 | - | 58 | - | - | Antitoxin |
| CSB76_RS09670 | 1901143..1901244 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| CSB76_RS09675 | 1901222..1901383 | - | 162 | Protein_1782 | transposase | - |
| CSB76_RS09680 | 1901374..1901868 | - | 495 | Protein_1783 | transposase | - |
| CSB76_RS09685 | 1902320..1903549 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| CSB76_RS09690 | 1903542..1905098 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| CSB76_RS09695 | 1905262..1905396 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1895330..1930607 | 35277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106255 WP_001801861.1 NZ_CP029673:1900925-1901020 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106255 NZ_CP029673:1900925-1901020 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106255 NZ_CP029673:c1901105-1901048 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|