Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2313772..2313952 | Replicon | chromosome |
Accession | NZ_CP029671 | ||
Organism | Staphylococcus aureus strain AR_0222 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSB78_RS12030 | Protein ID | WP_001801861.1 |
Coordinates | 2313857..2313952 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2313772..2313829 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB78_RS12000 | 2309481..2309615 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CSB78_RS12005 | 2309779..2311335 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSB78_RS12010 | 2311328..2312557 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSB78_RS12015 | 2313009..2313503 | + | 495 | Protein_2170 | transposase | - |
CSB78_RS12020 | 2313494..2313655 | + | 162 | Protein_2171 | transposase | - |
CSB78_RS12025 | 2313633..2313734 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 2313772..2313829 | + | 58 | - | - | Antitoxin |
CSB78_RS12030 | 2313857..2313952 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSB78_RS12035 | 2314097..2315109 | + | 1013 | Protein_2174 | IS3 family transposase | - |
CSB78_RS12040 | 2315307..2315879 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CSB78_RS12045 | 2315980..2316321 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSB78_RS12050 | 2316362..2316987 | - | 626 | Protein_2177 | hypothetical protein | - |
CSB78_RS12055 | 2317062..2318057 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSB78_RS12060 | 2318138..2318788 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 2286939..2318752 | 31813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106252 WP_001801861.1 NZ_CP029671:c2313952-2313857 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106252 NZ_CP029671:c2313952-2313857 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106252 NZ_CP029671:2313772-2313829 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|