Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1009793..1009973 | Replicon | chromosome |
Accession | NZ_CP029663 | ||
Organism | Staphylococcus aureus strain AR_0228 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSB84_RS05650 | Protein ID | WP_001801861.1 |
Coordinates | 1009878..1009973 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1009793..1009850 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSB84_RS05620 | 1005502..1005636 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CSB84_RS05625 | 1005800..1007356 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSB84_RS05630 | 1007349..1008578 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSB84_RS05635 | 1009030..1009524 | + | 495 | Protein_955 | transposase | - |
CSB84_RS05640 | 1009515..1009676 | + | 162 | Protein_956 | transposase | - |
CSB84_RS05645 | 1009654..1009755 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1009793..1009850 | + | 58 | - | - | Antitoxin |
CSB84_RS05650 | 1009878..1009973 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSB84_RS05655 | 1010118..1011130 | + | 1013 | Protein_959 | IS3 family transposase | - |
CSB84_RS05660 | 1011328..1011900 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CSB84_RS05665 | 1012001..1012342 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSB84_RS05670 | 1012383..1013009 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CSB84_RS05675 | 1013084..1014079 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSB84_RS05680 | 1014160..1014810 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 982960..1015569 | 32609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106171 WP_001801861.1 NZ_CP029663:c1009973-1009878 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106171 NZ_CP029663:c1009973-1009878 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106171 NZ_CP029663:1009793-1009850 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|