Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1108555..1108735 | Replicon | chromosome |
| Accession | NZ_CP029658 | ||
| Organism | Staphylococcus aureus strain AR_0467 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSC52_RS06145 | Protein ID | WP_001801861.1 |
| Coordinates | 1108640..1108735 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1108555..1108612 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC52_RS06115 | 1104264..1104398 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| CSC52_RS06120 | 1104562..1106118 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| CSC52_RS06125 | 1106111..1107340 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| CSC52_RS06130 | 1107792..1108286 | + | 495 | Protein_1106 | transposase | - |
| CSC52_RS06135 | 1108277..1108438 | + | 162 | Protein_1107 | transposase | - |
| CSC52_RS06140 | 1108416..1108517 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 1108555..1108612 | + | 58 | - | - | Antitoxin |
| CSC52_RS06145 | 1108640..1108735 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| CSC52_RS06150 | 1108880..1109892 | + | 1013 | Protein_1110 | IS3 family transposase | - |
| CSC52_RS06155 | 1110090..1110662 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| CSC52_RS06160 | 1110763..1111104 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| CSC52_RS06165 | 1111145..1111771 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| CSC52_RS06170 | 1111846..1112841 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| CSC52_RS06175 | 1112922..1113572 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 1072756..1114330 | 41574 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106156 WP_001801861.1 NZ_CP029658:c1108735-1108640 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106156 NZ_CP029658:c1108735-1108640 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106156 NZ_CP029658:1108555-1108612 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|