Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1940775..1940955 | Replicon | chromosome |
Accession | NZ_CP029657 | ||
Organism | Staphylococcus aureus strain AR_0468 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSC53_RS10015 | Protein ID | WP_001801861.1 |
Coordinates | 1940775..1940870 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1940898..1940955 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC53_RS09985 | 1935938..1936588 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
CSC53_RS09990 | 1936669..1937664 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSC53_RS09995 | 1937739..1938365 | + | 627 | WP_000669024.1 | hypothetical protein | - |
CSC53_RS10000 | 1938406..1938747 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSC53_RS10005 | 1938848..1939420 | + | 573 | WP_000414216.1 | hypothetical protein | - |
CSC53_RS10010 | 1939618..1940630 | - | 1013 | Protein_1851 | IS3 family transposase | - |
CSC53_RS10015 | 1940775..1940870 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1940898..1940955 | - | 58 | - | - | Antitoxin |
CSC53_RS10020 | 1940993..1941094 | + | 102 | WP_001792025.1 | hypothetical protein | - |
CSC53_RS10025 | 1941072..1941233 | - | 162 | Protein_1854 | transposase | - |
CSC53_RS10030 | 1941224..1941718 | - | 495 | Protein_1855 | transposase | - |
CSC53_RS10035 | 1942170..1943399 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSC53_RS10040 | 1943392..1944948 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSC53_RS10045 | 1945112..1945246 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1935180..1970458 | 35278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106128 WP_001801861.1 NZ_CP029657:1940775-1940870 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106128 NZ_CP029657:1940775-1940870 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106128 NZ_CP029657:c1940955-1940898 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|