Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1528866..1529046 | Replicon | chromosome |
Accession | NZ_CP029655 | ||
Organism | Staphylococcus aureus strain AR_0469 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSC54_RS08255 | Protein ID | WP_001801861.1 |
Coordinates | 1528951..1529046 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1528866..1528923 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC54_RS08225 | 1524575..1524709 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CSC54_RS08230 | 1524873..1526429 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CSC54_RS08235 | 1526422..1527651 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSC54_RS08240 | 1528103..1528597 | + | 495 | Protein_1460 | transposase | - |
CSC54_RS08245 | 1528588..1528749 | + | 162 | Protein_1461 | transposase | - |
CSC54_RS08250 | 1528727..1528828 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1528866..1528923 | + | 58 | - | - | Antitoxin |
CSC54_RS08255 | 1528951..1529046 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CSC54_RS08260 | 1529191..1530203 | + | 1013 | Protein_1464 | IS3 family transposase | - |
CSC54_RS08265 | 1530401..1530973 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CSC54_RS08270 | 1531074..1531415 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSC54_RS08275 | 1531456..1532082 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CSC54_RS08280 | 1532157..1533152 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSC54_RS08285 | 1533233..1533883 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 1502033..1534642 | 32609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T106121 WP_001801861.1 NZ_CP029655:c1529046-1528951 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T106121 NZ_CP029655:c1529046-1528951 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT106121 NZ_CP029655:1528866-1528923 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|