Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2550608..2550788 | Replicon | chromosome |
| Accession | NZ_CP029474 | ||
| Organism | Staphylococcus aureus strain USA 100 isolate 30-47 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DKK89_RS12910 | Protein ID | WP_001801861.1 |
| Coordinates | 2550608..2550703 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2550731..2550788 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKK89_RS12880 | 2545771..2546421 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| DKK89_RS12885 | 2546502..2547497 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| DKK89_RS12890 | 2547572..2548198 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| DKK89_RS12895 | 2548239..2548580 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| DKK89_RS12900 | 2548681..2549253 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| DKK89_RS12905 | 2549451..2550463 | - | 1013 | Protein_2413 | IS3 family transposase | - |
| DKK89_RS12910 | 2550608..2550703 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2550731..2550788 | - | 58 | - | - | Antitoxin |
| DKK89_RS12915 | 2550826..2550927 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| DKK89_RS12920 | 2550905..2551066 | - | 162 | Protein_2416 | transposase | - |
| DKK89_RS12925 | 2551057..2551551 | - | 495 | Protein_2417 | transposase | - |
| DKK89_RS12930 | 2552003..2553232 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| DKK89_RS12935 | 2553225..2554781 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| DKK89_RS12940 | 2554945..2555079 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 2545012..2580293 | 35281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T105702 WP_001801861.1 NZ_CP029474:2550608-2550703 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T105702 NZ_CP029474:2550608-2550703 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT105702 NZ_CP029474:c2550788-2550731 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|