Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 410415..410595 | Replicon | chromosome |
Accession | NZ_CP029086 | ||
Organism | Staphylococcus aureus strain AR462 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CSC48_RS02070 | Protein ID | WP_001801861.1 |
Coordinates | 410415..410510 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 410538..410595 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC48_RS02040 | 405578..406228 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
CSC48_RS02045 | 406309..407304 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CSC48_RS02050 | 407379..408005 | + | 627 | WP_000669024.1 | hypothetical protein | - |
CSC48_RS02055 | 408046..408387 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
CSC48_RS02060 | 408488..409060 | + | 573 | WP_000414216.1 | hypothetical protein | - |
CSC48_RS02065 | 409258..410270 | - | 1013 | Protein_366 | IS3 family transposase | - |
CSC48_RS02070 | 410415..410510 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 410538..410595 | - | 58 | - | - | Antitoxin |
CSC48_RS02075 | 410633..410734 | + | 102 | WP_001792025.1 | hypothetical protein | - |
CSC48_RS02080 | 410712..410873 | - | 162 | Protein_369 | transposase | - |
CSC48_RS02085 | 410864..411358 | - | 495 | Protein_370 | transposase | - |
CSC48_RS02090 | 411810..413039 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CSC48_RS02095 | 413032..414588 | - | 1557 | WP_031862851.1 | type I restriction-modification system subunit M | - |
CSC48_RS02100 | 414752..414886 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 404820..436551 | 31731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T104785 WP_001801861.1 NZ_CP029086:410415-410510 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T104785 NZ_CP029086:410415-410510 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT104785 NZ_CP029086:c410595-410538 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|