Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1859350..1859530 | Replicon | chromosome |
| Accession | NZ_CP029082 | ||
| Organism | Staphylococcus aureus strain AR465 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSC50_RS10120 | Protein ID | WP_001801861.1 |
| Coordinates | 1859435..1859530 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1859350..1859407 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC50_RS10090 | 1855059..1855193 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| CSC50_RS10095 | 1855357..1856913 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| CSC50_RS10100 | 1856906..1858135 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| CSC50_RS10105 | 1858587..1859081 | + | 495 | Protein_1815 | transposase | - |
| CSC50_RS10110 | 1859072..1859233 | + | 162 | Protein_1816 | transposase | - |
| CSC50_RS10115 | 1859211..1859312 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 1859350..1859407 | + | 58 | - | - | Antitoxin |
| CSC50_RS10120 | 1859435..1859530 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| CSC50_RS10125 | 1859675..1860687 | + | 1013 | Protein_1819 | IS3 family transposase | - |
| CSC50_RS10130 | 1860885..1861457 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| CSC50_RS10135 | 1861558..1861899 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| CSC50_RS10140 | 1861940..1862566 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| CSC50_RS10145 | 1862641..1863636 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| CSC50_RS10150 | 1863717..1864367 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 1834449..1866762 | 32313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T104771 WP_001801861.1 NZ_CP029082:c1859530-1859435 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T104771 NZ_CP029082:c1859530-1859435 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT104771 NZ_CP029082:1859350-1859407 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|