Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1929117..1929299 | Replicon | chromosome |
Accession | NZ_CP029031 | ||
Organism | Staphylococcus aureus strain CIT |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DDG67_RS09795 | Protein ID | WP_001801861.1 |
Coordinates | 1929117..1929212 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1929240..1929299 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DDG67_RS09745 | 1924777..1925403 | + | 627 | Protein_1841 | hypothetical protein | - |
DDG67_RS09750 | 1925444..1925788 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
DDG67_RS09755 | 1925886..1926437 | + | 552 | WP_000414205.1 | hypothetical protein | - |
DDG67_RS09760 | 1926655..1927296 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DDG67_RS09765 | 1927410..1927595 | - | 186 | WP_000809857.1 | hypothetical protein | - |
DDG67_RS09770 | 1927597..1927773 | - | 177 | WP_000375476.1 | hypothetical protein | - |
DDG67_RS09775 | 1927784..1928167 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DDG67_RS09785 | 1928771..1928914 | - | 144 | WP_001549059.1 | transposase | - |
DDG67_RS09795 | 1929117..1929212 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1929240..1929299 | - | 60 | - | - | Antitoxin |
DDG67_RS09800 | 1929335..1929436 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DDG67_RS09805 | 1929414..1929590 | - | 177 | Protein_1851 | transposase | - |
DDG67_RS09810 | 1929784..1930161 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1922217..1962388 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T104602 WP_001801861.1 NZ_CP029031:1929117-1929212 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T104602 NZ_CP029031:1929117-1929212 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT104602 NZ_CP029031:c1929299-1929240 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|