Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2613511..2613736 Replicon chromosome
Accession NZ_CP028598
Organism Escherichia coli strain 148

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag C9E70_RS13565 Protein ID WP_000813258.1
Coordinates 2613581..2613736 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2613511..2613569 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C9E70_RS13515 2608576..2608818 + 243 WP_000747948.1 hypothetical protein -
C9E70_RS13520 2608802..2609227 + 426 WP_000693878.1 Rha family transcriptional regulator -
C9E70_RS13525 2609296..2610339 + 1044 WP_001262402.1 hypothetical protein -
C9E70_RS13530 2610332..2610793 + 462 WP_000139447.1 replication protein -
C9E70_RS13535 2610827..2611543 + 717 WP_000450627.1 DUF1627 domain-containing protein -
C9E70_RS13540 2611576..2611857 + 282 WP_000603384.1 DNA-binding protein -
C9E70_RS13545 2611854..2612081 + 228 WP_000699808.1 hypothetical protein -
C9E70_RS13550 2612074..2612385 + 312 WP_001289673.1 hypothetical protein -
C9E70_RS13555 2612513..2612731 + 219 WP_000683609.1 DUF4014 family protein -
C9E70_RS13560 2612733..2613290 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2613511..2613569 - 59 - - Antitoxin
C9E70_RS13565 2613581..2613736 + 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
C9E70_RS13570 2613856..2614200 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
C9E70_RS13575 2614322..2614594 + 273 WP_000191872.1 hypothetical protein -
C9E70_RS13580 2614596..2615645 + 1050 WP_001265229.1 DUF968 domain-containing protein -
C9E70_RS13585 2615658..2615963 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
C9E70_RS13590 2616026..2616580 + 555 WP_000640035.1 DUF1133 family protein -
C9E70_RS13595 2616805..2617002 + 198 WP_000917763.1 hypothetical protein -
C9E70_RS13600 2617138..2617851 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
C9E70_RS13615 2618302..2618733 + 432 WP_001302123.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2552844..2644187 91343


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T101665 WP_000813258.1 NZ_CP028598:2613581-2613736 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T101665 NZ_CP028598:2613581-2613736 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT101665 NZ_CP028598:c2613569-2613511 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References