Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2613511..2613736 | Replicon | chromosome |
| Accession | NZ_CP028598 | ||
| Organism | Escherichia coli strain 148 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | C9E70_RS13565 | Protein ID | WP_000813258.1 |
| Coordinates | 2613581..2613736 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2613511..2613569 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E70_RS13515 | 2608576..2608818 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| C9E70_RS13520 | 2608802..2609227 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| C9E70_RS13525 | 2609296..2610339 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| C9E70_RS13530 | 2610332..2610793 | + | 462 | WP_000139447.1 | replication protein | - |
| C9E70_RS13535 | 2610827..2611543 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| C9E70_RS13540 | 2611576..2611857 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| C9E70_RS13545 | 2611854..2612081 | + | 228 | WP_000699808.1 | hypothetical protein | - |
| C9E70_RS13550 | 2612074..2612385 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| C9E70_RS13555 | 2612513..2612731 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| C9E70_RS13560 | 2612733..2613290 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2613511..2613569 | - | 59 | - | - | Antitoxin |
| C9E70_RS13565 | 2613581..2613736 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C9E70_RS13570 | 2613856..2614200 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| C9E70_RS13575 | 2614322..2614594 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| C9E70_RS13580 | 2614596..2615645 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| C9E70_RS13585 | 2615658..2615963 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E70_RS13590 | 2616026..2616580 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| C9E70_RS13595 | 2616805..2617002 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| C9E70_RS13600 | 2617138..2617851 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| C9E70_RS13615 | 2618302..2618733 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | nleG7' | 2552844..2644187 | 91343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101665 WP_000813258.1 NZ_CP028598:2613581-2613736 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101665 NZ_CP028598:2613581-2613736 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101665 NZ_CP028598:c2613569-2613511 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|