Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2560365..2560549 | Replicon | chromosome |
| Accession | NC_009641 | ||
| Organism | Staphylococcus aureus subsp. aureus str. Newman | ||
| T1TAdb ID | TA07117 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 2560442..2560549 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2560365..2560425 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWMN_RS13390 | 2555895..2556062 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| NWMN_RS13400 (NWMN_2327) | 2556293..2558026 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| NWMN_RS13405 (NWMN_2328) | 2558051..2559814 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2560365..2560425 | + | 61 | - | - | Antitoxin |
| NWMN_RS13415 | 2560442..2560549 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NWMN_RS13420 (NWMN_2330) | 2560683..2561069 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| NWMN_RS13425 (NWMN_2331) | 2561337..2562479 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NWMN_RS13430 (NWMN_2332) | 2562539..2563198 | + | 660 | WP_000831298.1 | membrane protein | - |
| NWMN_RS13435 (NWMN_2333) | 2563380..2564591 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NWMN_RS13440 (NWMN_2334) | 2564714..2565187 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T10149 - NC_009641:c2560549-2560442 [Staphylococcus aureus subsp. aureus str. Newman]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T10149 NC_009641:c2560549-2560442 [Staphylococcus aureus subsp. aureus str. Newman]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT10149 NC_009641:2560365-2560425 [Staphylococcus aureus subsp. aureus str. Newman]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10024 | Staphylococcus aureus subsp. aureus str. Newman |
46.429 |
90.323 |
0.419 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Noëlla Germain-Amiot et al. (2019) A novel Staphylococcus aureus cis-trans type I toxin-antitoxin module with dual effects on bacteria and host cells. Nucleic Acids Research 47(4):1759-1773. [PubMed:30544243]