Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | aapA-IsoA/- |
| Location | 1245705..1245844 | Replicon | chromosome |
| Accession | NC_000915 | ||
| Organism | Helicobacter pylori 26695 | ||
| T1TAdb ID | TA00125 | ||
Toxin (Protein)
| Gene name | AapA1 | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 1245752..1245844 (+) | Length | 31 a.a. |
Antitoxin (RNA)
| Gene name | IsoA1 | ||
| Locus tag | - | ||
| Coordinates | 1245705..1245780 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HP_RS05775 (HP1175) | 1241825..1243132 | - | 1308 | WP_000505472.1 | NCS2 family permease | - |
| HP_RS05780 (HP1177) | 1243583..1245508 | - | 1926 | WP_000751514.1 | Hop family adhesin HopQ | - |
| - | 1245705..1245780 | - | 76 | - | - | Antitoxin |
| - | 1245752..1245844 | + | 93 | - | - | Toxin |
| HP_RS05785 (HP1178) | 1245964..1246665 | - | 702 | WP_000187711.1 | purine-nucleoside phosphorylase | - |
| HP_RS05790 (HP1179) | 1246662..1247903 | - | 1242 | WP_001172180.1 | phosphopentomutase | - |
| HP_RS05795 (HP1180) | 1247915..1249171 | - | 1257 | WP_000577889.1 | NupC/NupG family nucleoside CNT transporter | - |
| HP_RS05805 (HP1181) | 1249488..1250819 | + | 1332 | WP_000473297.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3463.29 Da Isoelectric Point: 11.1176
>T10085 - NC_000915:1245752-1245844 [Helicobacter pylori 26695]
MATKHGKNSWKTLYLKISFLGCKVVVLLKR
MATKHGKNSWKTLYLKISFLGCKVVVLLKR
Download Length: 93 bp
>T10085 NC_000915:1245752-1245844 [Helicobacter pylori 26695]
ATGGCTACCAAACATGGCAAAAACTCTTGGAAAACATTATACCTCAAAATTTCATTTTTGGGGTGTAAAGTTGTTGTTTT
ATTGAAGCGGTAG
ATGGCTACCAAACATGGCAAAAACTCTTGGAAAACATTATACCTCAAAATTTCATTTTTGGGGTGTAAAGTTGTTGTTTT
ATTGAAGCGGTAG
Antitoxin
Download Length: 76 bp
>AT10085 NC_000915:c1245780-1245705 [Helicobacter pylori 26695]
CAAGAGTTTTTGCCATGTTTGGTAGCCATGACAAACTCCTTTTATGGATTTATCCCCATAATTGCACTTATGGGGG
CAAGAGTTTTTGCCATGTTTGGTAGCCATGACAAACTCCTTTTATGGATTTATCCCCATAATTGCACTTATGGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10113 | Helicobacter pylori 26695 |
60 |
100 |
0.6 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Lamya El Mortaji et al. (2020) A peptide of a type I toxin-antitoxin system induces Helicobacter pylori morphological transformation from spiral shape to coccoids. Proceedings of The National Academy of Sciences of The United States of America 117(49):31398-31409. [PubMed:33229580]
(2) Dursun Nizam Korkut et al. (2020) Structural insights into the AapA1 toxin of Helicobacter pylori. Biochimica Et Biophysica Acta. General Subjects 1864(1):129423. [PubMed:31476357]
(3) Hélène Arnion et al. (2017) Mechanistic insights into type I toxin antitoxin systems in Helicobacter pylori: the importance of mRNA folding in controlling toxin expression. Nucleic Acids Research 45(8):4782-4795. [PubMed:28077560]