Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 381642..381836 | Replicon | chromosome |
| Accession | NC_004668 | ||
| Organism | Enterococcus faecalis V583 | ||
| T1TAdb ID | TA04744 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | EF_RS02030 | Protein ID | - |
| Coordinates | 381741..381836 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 381642..381706 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF_RS02015 (EF0406) | 377275..379017 | + | 1743 | WP_002399652.1 | PTS transporter subunit EIIC | - |
| EF_RS02020 (EF0407) | 379008..381041 | + | 2034 | WP_002387671.1 | PRD domain-containing protein | - |
| EF_RS02025 (EF0408) | 381052..381486 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - | 381642..381706 | + | 65 | - | - | Antitoxin |
| EF_RS02030 | 381741..381836 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| EF_RS02035 (EF0411) | 382082..383854 | + | 1773 | WP_010706745.1 | PTS mannitol-specific transporter subunit IIBC | - |
| EF_RS02040 (EF0412) | 383869..384306 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| EF_RS02045 (EF0413) | 384321..385475 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| EF_RS02050 (EF0414) | 385542..386657 | - | 1116 | WP_002379062.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T10029 NC_004668:c381836-381741 [Enterococcus faecalis V583]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T10029 NC_004668:c381836-381741 [Enterococcus faecalis V583]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT10029 NC_004668:381642-381706 [Enterococcus faecalis V583]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10028 | Enterococcus faecalis V583 |
39.13 |
100 |
0.391 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) T J Greenfield et al. (2001) Antisense RNA regulation of the par post-segregational killing system: structural analysis and mechanism of binding of the antisense RNA, RNAII and its target, RNAI. Molecular Microbiology 42(2):527-37. [PubMed:11703673]