TAfinder detailed results

Overview

Job ID wrVbGpMxFf
Sequence name NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome
Predicted type II

Orphan Antitoxin (Protein)


Predicted family PsyrA (AT6032) Predicted domain -
Locus tag orf2468 Length 57 a.a.
Coordinates 2601001..2601174 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
orf2459 2596742..2596951 + 210 ORF2459 Predicted ORF by PRODIGAL Version 1.20 -
orf2460 2597030..2597245 + 216 ORF2460 Predicted ORF by PRODIGAL Version 1.20 -
orf2461 2597247..2598482 + 1236 ORF2461 Predicted ORF by PRODIGAL Version 1.20 -
orf2462 2598534..2599469 + 936 ORF2462 Predicted ORF by PRODIGAL Version 1.20 -
orf2463 2599598..2600971 - 1374 ORF2463 Predicted ORF by PRODIGAL Version 1.20 -
orf2464 2601001..2601174 - 174 ORF2464 Predicted ORF by PRODIGAL Version 1.20 Antitoxin
orf2465 2601449..2602432 - 984 ORF2465 Predicted ORF by PRODIGAL Version 1.20 -
orf2466 2602687..2603919 + 1233 ORF2466 Predicted ORF by PRODIGAL Version 1.20 -
orf2467 2603940..2604503 - 564 ORF2467 Predicted ORF by PRODIGAL Version 1.20 -
orf2468 2604833..2605741 - 909 ORF2468 Predicted ORF by PRODIGAL Version 1.20 -

Domains

The domains were predicted by HMMER and were sorted by score.

Orphan Antitoxin


No domain identified.



Sequences

Orphan Antitoxin        


Download         Length:         Molecular weight: 6427.51 Da        Isoelectric Point: 5.7207

>ORF2464 Orphan_TA_58 Antitoxin
MTTLIYLQIPVPEPIPGDPVPVPDPIPRPQPMPDPPPDEEPIKLSHRERRSARIRAC

Download         Length: 174 bp

>ORF2464 Orphan_TA_58 Antitoxin
TTAGCAGGCGCGTATCCTCGCAGATCTACGCTCACGATGCGACAATTTAATCGGTTCTTC
ATCAGGTGGTGGGTCAGGCATGGGTTGCGGGCGAGGGATCGGATCGGGCACTGGAACAGG
ATCGCCAGGAATCGGTTCAGGGACAGGAATTTGCAAATAAATAAGTGTCGTCAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
AT6032 Pseudomonas syringae pv. syringae B728a

37.778

9.89

0.298