Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EL086_RS09670 Genome accession   NZ_LR134274
Coordinates   2067196..2067426 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain NCTC8618     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2062196..2072426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL086_RS09635 (NCTC8618_04369) - 2062590..2063036 (-) 447 WP_037605837.1 hypothetical protein -
  EL086_RS09640 (NCTC8618_04370) - 2063110..2063766 (-) 657 WP_002887011.1 CPBP family intramembrane glutamic endopeptidase -
  EL086_RS09645 (NCTC8618_04371) - 2063778..2063975 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  EL086_RS09650 (NCTC8618_04372) - 2064226..2065419 (-) 1194 WP_002885831.1 acetate kinase -
  EL086_RS09655 (NCTC8618_04373) comGH 2065476..2066432 (-) 957 WP_038676858.1 class I SAM-dependent methyltransferase Machinery gene
  EL086_RS09660 (NCTC8618_04374) comGG 2066477..2066794 (-) 318 WP_002887013.1 competence type IV pilus minor pilin ComGG Machinery gene
  EL086_RS09665 (NCTC8618_04375) comGF 2066772..2067209 (-) 438 WP_002887014.1 competence type IV pilus minor pilin ComGF Machinery gene
  EL086_RS09670 (NCTC8618_04376) comGE 2067196..2067426 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  EL086_RS09675 (NCTC8618_04377) comGD 2067458..2067886 (-) 429 WP_254593949.1 competence type IV pilus minor pilin ComGD Machinery gene
  EL086_RS09680 (NCTC8618_04378) comGC 2067846..2068160 (-) 315 WP_170314557.1 competence type IV pilus major pilin ComGC Machinery gene
  EL086_RS09685 (NCTC8618_04379) comGB 2068169..2069269 (-) 1101 WP_126405090.1 competence type IV pilus assembly protein ComGB Machinery gene
  EL086_RS09690 (NCTC8618_04380) comGA/cglA/cilD 2069151..2070092 (-) 942 WP_038676863.1 competence type IV pilus ATPase ComGA Machinery gene
  EL086_RS09695 (NCTC8618_04381) - 2070172..2070534 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=999635 EL086_RS09670 WP_002887015.1 2067196..2067426(-) (comGE) [Streptococcus salivarius strain NCTC8618]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=999635 EL086_RS09670 WP_002887015.1 2067196..2067426(-) (comGE) [Streptococcus salivarius strain NCTC8618]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382