Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EW023_RS00685 Genome accession   NZ_LR130239
Coordinates   104252..104536 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain PS003 isolate PS003     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99252..109536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EW023_RS00660 - 101198..101563 (+) 366 WP_002986560.1 DUF1033 family protein -
  EW023_RS00665 comGA 101656..102594 (+) 939 WP_023612548.1 competence type IV pilus ATPase ComGA Machinery gene
  EW023_RS00670 comGB 102530..103564 (+) 1035 WP_229363300.1 competence type IV pilus assembly protein ComGB Machinery gene
  EW023_RS00675 comGC 103566..103892 (+) 327 WP_032465607.1 competence type IV pilus major pilin ComGC Machinery gene
  EW023_RS00680 comGD 103867..104295 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  EW023_RS00685 comGE 104252..104536 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  EW023_RS00690 comGF 104529..104963 (+) 435 WP_023612536.1 competence type IV pilus minor pilin ComGF Machinery gene
  EW023_RS00695 comGG 104947..105273 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  EW023_RS00700 comGH 105371..106324 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  EW023_RS00705 - 106383..107579 (+) 1197 WP_023612537.1 acetate kinase -
  EW023_RS00710 - 107766..108074 (+) 309 WP_032465606.1 hypothetical protein -
  EW023_RS00715 proC 108157..108927 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=994382 EW023_RS00685 WP_002987779.1 104252..104536(+) (comGE) [Streptococcus pyogenes strain PS003 isolate PS003]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=994382 EW023_RS00685 WP_002987779.1 104252..104536(+) (comGE) [Streptococcus pyogenes strain PS003 isolate PS003]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment