Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAHT66_RS12005 Genome accession   NZ_CP154441
Coordinates   2300253..2300426 (-) Length   57 a.a.
NCBI ID   WP_087990694.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain XN303     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2295253..2305426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT66_RS11960 (AAHT66_11960) comGE 2295613..2295960 (+) 348 WP_087990700.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAHT66_RS11965 (AAHT66_11965) comGF 2295962..2296369 (+) 408 WP_284690388.1 competence type IV pilus minor pilin ComGF Machinery gene
  AAHT66_RS11970 (AAHT66_11970) comGG 2296370..2296744 (+) 375 WP_202327198.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAHT66_RS11975 (AAHT66_11975) - 2296813..2296992 (+) 180 WP_087990697.1 YqzE family protein -
  AAHT66_RS11980 (AAHT66_11980) - 2297036..2297365 (-) 330 WP_087990817.1 YqzG/YhdC family protein -
  AAHT66_RS11985 (AAHT66_11985) tapA 2297627..2298388 (+) 762 WP_202327199.1 amyloid fiber anchoring/assembly protein TapA -
  AAHT66_RS11990 (AAHT66_11990) - 2298372..2298944 (+) 573 WP_087990816.1 signal peptidase I SipW -
  AAHT66_RS11995 (AAHT66_11995) tasA 2299007..2299792 (+) 786 WP_087990695.1 biofilm matrix protein TasA -
  AAHT66_RS12000 (AAHT66_12000) sinR 2299884..2300219 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAHT66_RS12005 (AAHT66_12005) sinI 2300253..2300426 (-) 174 WP_087990694.1 anti-repressor SinI Regulator
  AAHT66_RS12010 (AAHT66_12010) - 2300610..2301404 (-) 795 WP_253268418.1 YqhG family protein -
  AAHT66_RS12015 (AAHT66_12015) - 2301425..2303098 (-) 1674 WP_253268417.1 DEAD/DEAH box helicase -
  AAHT66_RS12020 (AAHT66_12020) gcvT 2303541..2304629 (+) 1089 WP_087990691.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6631.70 Da        Isoelectric Point: 10.1505

>NTDB_id=993367 AAHT66_RS12005 WP_087990694.1 2300253..2300426(-) (sinI) [Bacillus inaquosorum strain XN303]
MKNAKQEHFELDQEWVKLMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=993367 AAHT66_RS12005 WP_087990694.1 2300253..2300426(-) (sinI) [Bacillus inaquosorum strain XN303]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTAAATTGATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947


Multiple sequence alignment