Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HMPREF9425_RS00695 Genome accession   NZ_GL831112
Coordinates   134646..134876 (+) Length   76 a.a.
NCBI ID   WP_003095891.1    Uniprot ID   A0ABP2KL85
Organism   Streptococcus vestibularis ATCC 49124     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 129646..139876
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HMPREF9425_RS00670 (HMPREF9425_0138) - 131537..131899 (+) 363 WP_003095881.1 DUF1033 family protein -
  HMPREF9425_RS00675 (HMPREF9425_0139) comGA 131980..132921 (+) 942 WP_003095883.1 competence type IV pilus ATPase ComGA Machinery gene
  HMPREF9425_RS00680 (HMPREF9425_0140) comGB 132803..133903 (+) 1101 WP_155809878.1 competence type IV pilus assembly protein ComGB Machinery gene
  HMPREF9425_RS00685 (HMPREF9425_0141) comGC 133900..134226 (+) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  HMPREF9425_RS00690 (HMPREF9425_0142) comGD 134186..134614 (+) 429 WP_253665936.1 competence type IV pilus minor pilin ComGD Machinery gene
  HMPREF9425_RS00695 (HMPREF9425_0143) comGE 134646..134876 (+) 231 WP_003095891.1 competence type IV pilus minor pilin ComGE Machinery gene
  HMPREF9425_RS00700 (HMPREF9425_0144) comGF 134863..135300 (+) 438 WP_003091908.1 competence type IV pilus minor pilin ComGF Machinery gene
  HMPREF9425_RS00705 (HMPREF9425_0145) comGG 135278..135595 (+) 318 WP_003092009.1 competence type IV pilus minor pilin ComGG Machinery gene
  HMPREF9425_RS00710 (HMPREF9425_0146) comGH 135640..136596 (+) 957 WP_003091902.1 class I SAM-dependent methyltransferase Machinery gene
  HMPREF9425_RS00715 (HMPREF9425_0147) - 136653..137846 (+) 1194 WP_003095894.1 acetate kinase -
  HMPREF9425_RS00720 (HMPREF9425_0148) - 138097..138294 (+) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  HMPREF9425_RS00725 (HMPREF9425_0149) - 138308..138751 (+) 444 WP_037621248.1 hypothetical protein -
  HMPREF9425_RS00730 (HMPREF9425_0150) - 138851..139513 (+) 663 WP_003095899.1 CPBP family intramembrane glutamic endopeptidase -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8417.84 Da        Isoelectric Point: 10.6777

>NTDB_id=989470 HMPREF9425_RS00695 WP_003095891.1 134646..134876(+) (comGE) [Streptococcus vestibularis ATCC 49124]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGITVYESGKEITHVSK

Nucleotide


Download         Length: 231 bp        

>NTDB_id=989470 HMPREF9425_RS00695 WP_003095891.1 134646..134876(+) (comGE) [Streptococcus vestibularis ATCC 49124]
ATGGCTGTTTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCTACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGTATCACAGTGA
CAGTAAAACGTAGCAAGCAGGGCATCACAGTTTATGAATCAGGAAAGGAAATTACTCATGTCTCTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

36.842

100

0.368

  comGE Streptococcus mutans UA159

36.842

100

0.368