Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   V7S45_RS18710 Genome accession   NZ_CP152433
Coordinates   3670531..3671310 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus sp. BR3(2024)     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3645238..3706995 3670531..3671310 within 0


Gene organization within MGE regions


Location: 3645238..3706995
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S45_RS18600 (V7S45_18605) - 3645808..3646707 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  V7S45_RS18605 (V7S45_18610) pnp 3646859..3648997 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  V7S45_RS18610 (V7S45_18615) rpsO 3649158..3649427 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  V7S45_RS18615 (V7S45_18620) ribF 3649528..3650499 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  V7S45_RS18620 (V7S45_18625) truB 3650543..3651466 (-) 924 WP_025688876.1 tRNA pseudouridine(55) synthase TruB -
  V7S45_RS18625 (V7S45_18630) rbfA 3651553..3651909 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  V7S45_RS18630 (V7S45_18635) - 3651925..3652206 (-) 282 WP_000582363.1 DUF503 family protein -
  V7S45_RS18635 (V7S45_18640) infB 3652203..3654263 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  V7S45_RS18640 (V7S45_18645) - 3654268..3654579 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  V7S45_RS18645 (V7S45_18650) - 3654580..3654852 (-) 273 WP_000071127.1 YlxR family protein -
  V7S45_RS18650 (V7S45_18655) nusA 3654864..3655970 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  V7S45_RS18655 (V7S45_18660) rimP 3655988..3656458 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  V7S45_RS18660 (V7S45_18665) - 3656795..3661096 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  V7S45_RS18665 (V7S45_18670) - 3661221..3662921 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  V7S45_RS18670 (V7S45_18675) rseP 3663031..3664287 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  V7S45_RS18675 (V7S45_18680) dxr 3664305..3665447 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  V7S45_RS18680 (V7S45_18685) cdsA 3665471..3666262 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  V7S45_RS18685 (V7S45_18690) uppS 3666280..3667056 (-) 777 WP_257115651.1 isoprenyl transferase -
  V7S45_RS18690 (V7S45_18695) frr 3667142..3667699 (-) 558 WP_000531501.1 ribosome recycling factor -
  V7S45_RS18695 (V7S45_18700) pyrH 3667702..3668424 (-) 723 WP_000042668.1 UMP kinase -
  V7S45_RS18700 (V7S45_18705) tsf 3668491..3669378 (-) 888 WP_001018578.1 translation elongation factor Ts -
  V7S45_RS18705 (V7S45_18710) rpsB 3669482..3670183 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  V7S45_RS18710 (V7S45_18715) codY 3670531..3671310 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  V7S45_RS18715 (V7S45_18720) hslU 3671388..3672779 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  V7S45_RS18720 (V7S45_18725) hslV 3672802..3673344 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  V7S45_RS18725 (V7S45_18730) xerC 3673387..3674286 (-) 900 WP_025688856.1 tyrosine recombinase XerC -
  V7S45_RS18730 (V7S45_18735) trmFO 3674352..3675656 (-) 1305 WP_000213003.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V7S45_RS18735 (V7S45_18740) topA 3675705..3677783 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  V7S45_RS18740 (V7S45_18745) dprA 3677928..3678797 (-) 870 WP_000818060.1 DNA-processing protein DprA -
  V7S45_RS18745 (V7S45_18750) sucD 3678886..3679788 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  V7S45_RS18750 (V7S45_18755) sucC 3679808..3680968 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  V7S45_RS18755 (V7S45_18760) - 3681163..3681936 (-) 774 WP_001194265.1 ribonuclease HII -
  V7S45_RS18760 (V7S45_18765) ylqF 3681993..3682883 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  V7S45_RS18765 (V7S45_18770) lepB 3682904..3683455 (-) 552 WP_000711853.1 signal peptidase I -
  V7S45_RS18770 (V7S45_18775) rplS 3683557..3683901 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  V7S45_RS18775 (V7S45_18780) trmD 3684048..3684782 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V7S45_RS18780 (V7S45_18785) rimM 3684782..3685297 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  V7S45_RS18785 (V7S45_18790) - 3685419..3685646 (-) 228 WP_000737401.1 KH domain-containing protein -
  V7S45_RS18790 (V7S45_18795) rpsP 3685661..3685933 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  V7S45_RS18795 (V7S45_18800) ffh 3686035..3687384 (-) 1350 WP_000863460.1 signal recognition particle protein -
  V7S45_RS18800 (V7S45_18805) - 3687397..3687729 (-) 333 WP_000891062.1 putative DNA-binding protein -
  V7S45_RS18805 (V7S45_18810) ftsY 3687863..3688852 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  V7S45_RS18810 (V7S45_18815) smc 3688868..3692437 (-) 3570 WP_000478973.1 chromosome segregation protein SMC -
  V7S45_RS18815 (V7S45_18820) rncS 3692584..3693321 (-) 738 WP_001146875.1 ribonuclease III -
  V7S45_RS18820 (V7S45_18825) acpP 3693380..3693613 (-) 234 WP_000786062.1 acyl carrier protein -
  V7S45_RS18825 (V7S45_18830) fabG 3693683..3694423 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  V7S45_RS18830 (V7S45_18835) fabD 3694423..3695367 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  V7S45_RS18835 (V7S45_18840) plsX 3695382..3696374 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  V7S45_RS18840 (V7S45_18845) fapR 3696371..3696964 (-) 594 WP_000747348.1 transcription factor FapR -
  V7S45_RS18845 (V7S45_18850) recG 3697052..3699100 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  V7S45_RS18850 (V7S45_18855) - 3699391..3701067 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  V7S45_RS18855 (V7S45_18860) - 3701090..3701452 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  V7S45_RS18860 (V7S45_18865) rpmB 3701829..3702017 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  V7S45_RS18865 (V7S45_18870) spoVM 3702091..3702171 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  V7S45_RS18870 (V7S45_18875) - 3702238..3702918 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  V7S45_RS18875 (V7S45_18880) rpe 3702987..3703631 (-) 645 WP_071741402.1 ribulose-phosphate 3-epimerase -
  V7S45_RS18880 (V7S45_18885) rsgA 3703634..3704515 (-) 882 WP_001135536.1 ribosome small subunit-dependent GTPase A -
  V7S45_RS18885 (V7S45_18890) pknB 3704762..3706735 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=989375 V7S45_RS18710 WP_000421290.1 3670531..3671310(-) (codY) [Bacillus sp. BR3(2024)]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=989375 V7S45_RS18710 WP_000421290.1 3670531..3671310(-) (codY) [Bacillus sp. BR3(2024)]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment