Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37642_RS07245 | Genome accession | NZ_CP151468 |
| Coordinates | 1414773..1414952 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37642 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1414773..1455389 | 1414773..1414952 | within | 0 |
Gene organization within MGE regions
Location: 1414773..1455389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37642_RS07245 (MGAS37642_02970) | prx | 1414773..1414952 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37642_RS07250 (MGAS37642_02972) | sda1 | 1415191..1416363 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37642_RS07255 (MGAS37642_02974) | - | 1416479..1417675 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37642_RS07260 (MGAS37642_02978) | - | 1417786..1417971 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37642_RS07265 (MGAS37642_02980) | - | 1417968..1418267 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37642_RS07270 (MGAS37642_02982) | - | 1418278..1418898 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37642_RS07275 (MGAS37642_02984) | - | 1418901..1419062 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37642_RS07280 (MGAS37642_02986) | - | 1419071..1420978 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37642_RS07285 (MGAS37642_02988) | - | 1420989..1421624 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37642_RS07290 (MGAS37642_02990) | - | 1421624..1422679 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37642_RS07295 (MGAS37642_02992) | - | 1422676..1424658 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37642_RS07300 (MGAS37642_02994) | - | 1424668..1425510 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37642_RS07305 (MGAS37642_02996) | - | 1425522..1429904 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37642_RS07310 (MGAS37642_02998) | - | 1429919..1430152 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37642_RS07315 (MGAS37642_03000) | - | 1430227..1430682 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37642_RS07320 (MGAS37642_03002) | - | 1430736..1431335 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37642_RS07325 (MGAS37642_03004) | - | 1431347..1431706 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37642_RS07330 (MGAS37642_03006) | - | 1431710..1432054 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37642_RS07335 (MGAS37642_03008) | - | 1432051..1432329 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37642_RS07340 (MGAS37642_03010) | - | 1432340..1432696 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37642_RS07345 (MGAS37642_03012) | - | 1432708..1433595 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37642_RS07350 (MGAS37642_03014) | - | 1433608..1434177 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37642_RS07355 (MGAS37642_03016) | - | 1434333..1434599 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37642_RS07360 | - | 1434602..1434790 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37642_RS07365 (MGAS37642_03020) | - | 1434821..1436266 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37642_RS07370 (MGAS37642_03022) | - | 1436226..1437758 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS37642_RS07375 (MGAS37642_03024) | - | 1437774..1439051 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37642_RS07380 (MGAS37642_03026) | - | 1439041..1439493 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37642_RS07385 (MGAS37642_03028) | - | 1439583..1439999 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37642_RS07390 (MGAS37642_03030) | - | 1439996..1440187 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37642_RS07395 (MGAS37642_03032) | - | 1440177..1441028 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS37642_RS07400 (MGAS37642_03034) | - | 1441037..1441303 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37642_RS07405 (MGAS37642_03036) | - | 1441300..1441467 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37642_RS07410 (MGAS37642_03038) | - | 1441468..1442790 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37642_RS07415 (MGAS37642_03040) | - | 1442787..1443062 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37642_RS07420 (MGAS37642_03042) | - | 1443449..1445833 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37642_RS07425 (MGAS37642_03044) | - | 1445838..1447760 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37642_RS07430 (MGAS37642_03046) | - | 1447803..1448360 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37642_RS07435 (MGAS37642_03048) | - | 1448371..1448769 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37642_RS07440 (MGAS37642_03050) | - | 1448773..1449927 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37642_RS07445 (MGAS37642_03052) | - | 1449927..1450226 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37642_RS07450 (MGAS37642_03054) | - | 1450314..1450517 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37642_RS07455 (MGAS37642_03058) | - | 1450663..1451049 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37642_RS07460 (MGAS37642_03060) | - | 1451046..1451249 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37642_RS07465 (MGAS37642_03062) | - | 1451242..1451412 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37642_RS07470 (MGAS37642_03064) | - | 1451409..1451684 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37642_RS07475 (MGAS37642_03066) | - | 1451746..1451961 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37642_RS07480 (MGAS37642_03068) | - | 1452009..1452422 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37642_RS07485 (MGAS37642_03070) | - | 1452403..1452558 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37642_RS07490 (MGAS37642_03072) | - | 1452884..1453234 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37642_RS07495 (MGAS37642_03074) | - | 1453248..1453631 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37642_RS07500 (MGAS37642_03076) | - | 1453642..1454193 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37642_RS07505 (MGAS37642_03078) | - | 1454310..1455389 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=978507 MGAS37642_RS07245 WP_002988813.1 1414773..1414952(-) (prx) [Streptococcus pyogenes strain MGAS37642]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=978507 MGAS37642_RS07245 WP_002988813.1 1414773..1414952(-) (prx) [Streptococcus pyogenes strain MGAS37642]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |