Detailed information
Bioinformatically predicted
Overview
| Name | codY | Type | Regulator |
| Locus tag | AABL52_RS08360 | Genome accession | NZ_CP151108 |
| Coordinates | 1584624..1585403 (+) | Length | 259 a.a. |
| NCBI ID | WP_000421290.1 | Uniprot ID | A0A9W5VKA1 |
| Organism | Bacillus paramobilis strain IMGN7 | ||
| Function | repression of comK (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1553325..1619749 | 1584624..1585403 | within | 0 |
Gene organization within MGE regions
Location: 1553325..1619749
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABL52_RS08205 (AABL52_08205) | spoVM | 1553768..1553848 (+) | 81 | WP_001213599.1 | stage V sporulation protein SpoVM | - |
| AABL52_RS08210 (AABL52_08210) | rpmB | 1553922..1554110 (-) | 189 | WP_000124776.1 | 50S ribosomal protein L28 | - |
| AABL52_RS08215 (AABL52_08215) | - | 1554486..1554848 (+) | 363 | WP_000021109.1 | Asp23/Gls24 family envelope stress response protein | - |
| AABL52_RS08220 (AABL52_08220) | - | 1554871..1556547 (+) | 1677 | WP_000027124.1 | DAK2 domain-containing protein | - |
| AABL52_RS08225 (AABL52_08225) | recG | 1556838..1558886 (+) | 2049 | WP_341519149.1 | ATP-dependent DNA helicase RecG | - |
| AABL52_RS08230 (AABL52_08230) | fapR | 1558976..1559569 (+) | 594 | WP_000747352.1 | transcription factor FapR | - |
| AABL52_RS08235 (AABL52_08235) | plsX | 1559566..1560558 (+) | 993 | WP_000684108.1 | phosphate acyltransferase PlsX | - |
| AABL52_RS08240 (AABL52_08240) | fabD | 1560573..1561517 (+) | 945 | WP_341519150.1 | ACP S-malonyltransferase | - |
| AABL52_RS08245 (AABL52_08245) | fabG | 1561517..1562257 (+) | 741 | WP_000911781.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
| AABL52_RS08250 (AABL52_08250) | acpP | 1562327..1562560 (+) | 234 | WP_000786062.1 | acyl carrier protein | - |
| AABL52_RS08255 (AABL52_08255) | rncS | 1562619..1563356 (+) | 738 | WP_001146868.1 | ribonuclease III | - |
| AABL52_RS08260 (AABL52_08260) | smc | 1563504..1567073 (+) | 3570 | WP_341519151.1 | chromosome segregation protein SMC | - |
| AABL52_RS08265 (AABL52_08265) | ftsY | 1567089..1568078 (+) | 990 | WP_000007660.1 | signal recognition particle-docking protein FtsY | - |
| AABL52_RS08270 (AABL52_08270) | - | 1568212..1568544 (+) | 333 | WP_000891061.1 | putative DNA-binding protein | - |
| AABL52_RS08275 (AABL52_08275) | ffh | 1568557..1569906 (+) | 1350 | WP_000863466.1 | signal recognition particle protein | - |
| AABL52_RS08280 (AABL52_08280) | rpsP | 1570007..1570279 (+) | 273 | WP_000268750.1 | 30S ribosomal protein S16 | - |
| AABL52_RS08285 (AABL52_08285) | - | 1570294..1570521 (+) | 228 | WP_000737399.1 | KH domain-containing protein | - |
| AABL52_RS08290 (AABL52_08290) | rimM | 1570643..1571158 (+) | 516 | WP_000170281.1 | ribosome maturation factor RimM | - |
| AABL52_RS08295 (AABL52_08295) | trmD | 1571158..1571892 (+) | 735 | WP_061678208.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| AABL52_RS08300 (AABL52_08300) | rplS | 1572039..1572383 (+) | 345 | WP_001186518.1 | 50S ribosomal protein L19 | - |
| AABL52_RS08305 (AABL52_08305) | lepB | 1572485..1573036 (+) | 552 | WP_000711857.1 | signal peptidase I | - |
| AABL52_RS08310 (AABL52_08310) | ylqF | 1573057..1573947 (+) | 891 | WP_341519152.1 | ribosome biogenesis GTPase YlqF | - |
| AABL52_RS08315 (AABL52_08315) | - | 1573999..1574772 (+) | 774 | WP_088097494.1 | ribonuclease HII | - |
| AABL52_RS08320 (AABL52_08320) | sucC | 1574967..1576127 (+) | 1161 | WP_001020792.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| AABL52_RS08325 (AABL52_08325) | sucD | 1576147..1577049 (+) | 903 | WP_000115178.1 | succinate--CoA ligase subunit alpha | - |
| AABL52_RS08330 (AABL52_08330) | dprA | 1577137..1578006 (+) | 870 | WP_341519153.1 | DNA-processing protein DprA | - |
| AABL52_RS08335 (AABL52_08335) | topA | 1578151..1580229 (+) | 2079 | WP_001286953.1 | type I DNA topoisomerase | - |
| AABL52_RS08340 (AABL52_08340) | trmFO | 1580278..1581582 (+) | 1305 | WP_000211998.1 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO | - |
| AABL52_RS08345 (AABL52_08345) | xerC | 1581648..1582547 (+) | 900 | WP_001101238.1 | tyrosine recombinase XerC | - |
| AABL52_RS08350 (AABL52_08350) | hslV | 1582590..1583132 (+) | 543 | WP_000526271.1 | ATP-dependent protease proteolytic subunit HslV | - |
| AABL52_RS08355 (AABL52_08355) | hslU | 1583155..1584546 (+) | 1392 | WP_341519154.1 | ATP-dependent protease ATPase subunit HslU | - |
| AABL52_RS08360 (AABL52_08360) | codY | 1584624..1585403 (+) | 780 | WP_000421290.1 | GTP-sensing pleiotropic transcriptional regulator CodY | Regulator |
| AABL52_RS08365 (AABL52_08365) | rpsB | 1585754..1586455 (+) | 702 | WP_000111485.1 | 30S ribosomal protein S2 | - |
| AABL52_RS08370 (AABL52_08370) | tsf | 1586559..1587446 (+) | 888 | WP_001018583.1 | translation elongation factor Ts | - |
| AABL52_RS08375 (AABL52_08375) | pyrH | 1587513..1588235 (+) | 723 | WP_000042667.1 | UMP kinase | - |
| AABL52_RS08380 (AABL52_08380) | frr | 1588238..1588795 (+) | 558 | WP_000531505.1 | ribosome recycling factor | - |
| AABL52_RS08385 (AABL52_08385) | uppS | 1588881..1589657 (+) | 777 | WP_000971309.1 | isoprenyl transferase | - |
| AABL52_RS08390 (AABL52_08390) | cdsA | 1589675..1590466 (+) | 792 | WP_000813582.1 | phosphatidate cytidylyltransferase | - |
| AABL52_RS08395 (AABL52_08395) | dxr | 1590490..1591632 (+) | 1143 | WP_000790371.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| AABL52_RS08400 (AABL52_08400) | rseP | 1591650..1592906 (+) | 1257 | WP_001090236.1 | RIP metalloprotease RseP | - |
| AABL52_RS08405 (AABL52_08405) | - | 1593016..1594716 (+) | 1701 | WP_341519155.1 | proline--tRNA ligase | - |
| AABL52_RS08410 (AABL52_08410) | - | 1594841..1599142 (+) | 4302 | WP_098257916.1 | PolC-type DNA polymerase III | - |
| AABL52_RS08415 (AABL52_08415) | rimP | 1599475..1599945 (+) | 471 | WP_000359099.1 | ribosome maturation factor RimP | - |
| AABL52_RS08420 (AABL52_08420) | nusA | 1599963..1601069 (+) | 1107 | WP_000102596.1 | transcription termination factor NusA | - |
| AABL52_RS08425 (AABL52_08425) | - | 1601081..1601353 (+) | 273 | WP_000071127.1 | YlxR family protein | - |
| AABL52_RS08430 (AABL52_08430) | - | 1601354..1601665 (+) | 312 | WP_001286520.1 | YlxQ family RNA-binding protein | - |
| AABL52_RS08435 (AABL52_08435) | infB | 1601670..1603730 (+) | 2061 | WP_000036354.1 | translation initiation factor IF-2 | - |
| AABL52_RS08440 (AABL52_08440) | - | 1603727..1604008 (+) | 282 | WP_000582364.1 | DUF503 family protein | - |
| AABL52_RS08445 (AABL52_08445) | rbfA | 1604024..1604380 (+) | 357 | WP_000776444.1 | 30S ribosome-binding factor RbfA | - |
| AABL52_RS08450 (AABL52_08450) | truB | 1604467..1605390 (+) | 924 | WP_341519156.1 | tRNA pseudouridine(55) synthase TruB | - |
| AABL52_RS08455 (AABL52_08455) | ribF | 1605434..1606405 (+) | 972 | WP_000766717.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| AABL52_RS08460 (AABL52_08460) | rpsO | 1606506..1606775 (+) | 270 | WP_001229392.1 | 30S ribosomal protein S15 | - |
| AABL52_RS08465 (AABL52_08465) | pnp | 1606936..1609074 (+) | 2139 | WP_097844215.1 | polyribonucleotide nucleotidyltransferase | - |
| AABL52_RS08470 (AABL52_08470) | - | 1609225..1610124 (+) | 900 | WP_097844216.1 | polysaccharide deacetylase family protein | - |
| AABL52_RS08475 (AABL52_08475) | - | 1610211..1611452 (+) | 1242 | WP_341519157.1 | pitrilysin family protein | - |
| AABL52_RS08480 (AABL52_08480) | - | 1611583..1611834 (+) | 252 | WP_001239745.1 | YlmC/YmxH family sporulation protein | - |
| AABL52_RS08485 (AABL52_08485) | dpaA | 1612108..1613010 (+) | 903 | WP_000954734.1 | dipicolinic acid synthetase subunit A | - |
| AABL52_RS08490 (AABL52_08490) | dpaB | 1613007..1613606 (+) | 600 | WP_001049480.1 | dipicolinate synthase subunit B | - |
| AABL52_RS08495 (AABL52_08495) | asd | 1613757..1614803 (+) | 1047 | WP_000414853.1 | aspartate-semialdehyde dehydrogenase | - |
| AABL52_RS08500 (AABL52_08500) | dapG | 1614827..1616059 (+) | 1233 | WP_000692478.1 | aspartate kinase | - |
| AABL52_RS08505 (AABL52_08505) | dapA | 1616071..1616949 (+) | 879 | WP_000564778.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| AABL52_RS08510 (AABL52_08510) | - | 1617726..1619396 (+) | 1671 | WP_000823086.1 | ribonuclease J | - |
Sequence
Protein
Download Length: 259 a.a. Molecular weight: 28793.05 Da Isoelectric Point: 4.7165
>NTDB_id=974880 AABL52_RS08360 WP_000421290.1 1584624..1585403(+) (codY) [Bacillus paramobilis strain IMGN7]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN
Nucleotide
Download Length: 780 bp
>NTDB_id=974880 AABL52_RS08360 WP_000421290.1 1584624..1585403(+) (codY) [Bacillus paramobilis strain IMGN7]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATTGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCGGAAGAATACACGCAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCGTTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATCCTTGCTGAATACAGTTCAACTGTAGTAGGTATGGAAATCTTACGTGAAAAAGCGGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTAGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATTGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCGGAAGAATACACGCAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCGTTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATCCTTGCTGAATACAGTTCAACTGTAGTAGGTATGGAAATCTTACGTGAAAAAGCGGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTAGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| codY | Bacillus subtilis subsp. subtilis str. 168 |
81.467 |
100 |
0.815 |
| codY | Lactococcus lactis subsp. lactis strain DGCC12653 |
46.667 |
98.456 |
0.459 |