Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   V8V52_RS10110 Genome accession   NZ_CP150648
Coordinates   1937032..1937811 (+) Length   259 a.a.
NCBI ID   WP_002014541.1    Uniprot ID   -
Organism   Bacillus mycoides strain 4BM1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1899648..1962517 1937032..1937811 within 0


Gene organization within MGE regions


Location: 1899648..1962517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V8V52_RS09930 (V8V52_09930) - 1900651..1901403 (+) 753 WP_002014501.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  V8V52_RS09935 (V8V52_09935) pknB 1901412..1903385 (+) 1974 WP_088034475.1 Stk1 family PASTA domain-containing Ser/Thr kinase -
  V8V52_RS09940 (V8V52_09940) rsgA 1903656..1904537 (+) 882 WP_002014503.1 ribosome small subunit-dependent GTPase A -
  V8V52_RS09945 (V8V52_09945) rpe 1904540..1905184 (+) 645 WP_002014505.1 ribulose-phosphate 3-epimerase -
  V8V52_RS09950 (V8V52_09950) - 1905285..1905965 (+) 681 WP_002014506.1 thiamine diphosphokinase -
  V8V52_RS09955 (V8V52_09955) spoVM 1906032..1906112 (+) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  V8V52_RS09960 (V8V52_09960) rpmB 1906186..1906374 (-) 189 WP_000124776.1 50S ribosomal protein L28 -
  V8V52_RS09965 (V8V52_09965) - 1906753..1907115 (+) 363 WP_002014507.1 Asp23/Gls24 family envelope stress response protein -
  V8V52_RS09970 (V8V52_09970) - 1907138..1908814 (+) 1677 WP_002014508.1 DAK2 domain-containing protein -
  V8V52_RS09975 (V8V52_09975) recG 1909239..1911287 (+) 2049 WP_016100712.1 ATP-dependent DNA helicase RecG -
  V8V52_RS09980 (V8V52_09980) fapR 1911376..1911969 (+) 594 WP_000747354.1 transcription factor FapR -
  V8V52_RS09985 (V8V52_09985) plsX 1911966..1912958 (+) 993 WP_002128828.1 phosphate acyltransferase PlsX -
  V8V52_RS09990 (V8V52_09990) fabD 1912973..1913917 (+) 945 WP_088034478.1 ACP S-malonyltransferase -
  V8V52_RS09995 (V8V52_09995) fabG 1913917..1914657 (+) 741 WP_002014514.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  V8V52_RS10000 (V8V52_10000) acpP 1914727..1914960 (+) 234 WP_002014515.1 acyl carrier protein -
  V8V52_RS10005 (V8V52_10005) rncS 1915019..1915756 (+) 738 WP_002033792.1 ribonuclease III -
  V8V52_RS10010 (V8V52_10010) smc 1915905..1919474 (+) 3570 WP_088034480.1 chromosome segregation protein SMC -
  V8V52_RS10015 (V8V52_10015) ftsY 1919489..1920478 (+) 990 WP_002088200.1 signal recognition particle-docking protein FtsY -
  V8V52_RS10020 (V8V52_10020) - 1920611..1920943 (+) 333 WP_002033794.1 putative DNA-binding protein -
  V8V52_RS10025 (V8V52_10025) ffh 1920956..1922305 (+) 1350 WP_002014519.1 signal recognition particle protein -
  V8V52_RS10030 (V8V52_10030) rpsP 1922406..1922678 (+) 273 WP_000268750.1 30S ribosomal protein S16 -
  V8V52_RS10035 (V8V52_10035) - 1922693..1922920 (+) 228 WP_002088196.1 KH domain-containing protein -
  V8V52_RS10040 (V8V52_10040) rimM 1923042..1923557 (+) 516 WP_002014521.1 ribosome maturation factor RimM -
  V8V52_RS10045 (V8V52_10045) trmD 1923557..1924291 (+) 735 WP_002014522.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V8V52_RS10050 (V8V52_10050) rplS 1924438..1924782 (+) 345 WP_002014524.1 50S ribosomal protein L19 -
  V8V52_RS10055 (V8V52_10055) lepB 1924883..1925434 (+) 552 WP_002066791.1 signal peptidase I -
  V8V52_RS10060 (V8V52_10060) ylqF 1925455..1926345 (+) 891 WP_002014526.1 ribosome biogenesis GTPase YlqF -
  V8V52_RS10065 (V8V52_10065) - 1926401..1927174 (+) 774 WP_002014527.1 ribonuclease HII -
  V8V52_RS10070 (V8V52_10070) sucC 1927368..1928528 (+) 1161 WP_002014529.1 ADP-forming succinate--CoA ligase subunit beta -
  V8V52_RS10075 (V8V52_10075) sucD 1928548..1929450 (+) 903 WP_002033796.1 succinate--CoA ligase subunit alpha -
  V8V52_RS10080 (V8V52_10080) dprA 1929539..1930408 (+) 870 WP_088034482.1 DNA-processing protein DprA -
  V8V52_RS10085 (V8V52_10085) topA 1930553..1932631 (+) 2079 WP_002088184.1 type I DNA topoisomerase -
  V8V52_RS10090 (V8V52_10090) trmFO 1932680..1933984 (+) 1305 WP_002014534.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V8V52_RS10095 (V8V52_10095) xerC 1934056..1934955 (+) 900 WP_078175468.1 tyrosine recombinase XerC -
  V8V52_RS10100 (V8V52_10100) hslV 1934998..1935540 (+) 543 WP_002014538.1 ATP-dependent protease proteolytic subunit HslV -
  V8V52_RS10105 (V8V52_10105) hslU 1935563..1936954 (+) 1392 WP_002014539.1 ATP-dependent protease ATPase subunit HslU -
  V8V52_RS10110 (V8V52_10110) codY 1937032..1937811 (+) 780 WP_002014541.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  V8V52_RS10115 (V8V52_10115) rpsB 1938166..1938867 (+) 702 WP_002088178.1 30S ribosomal protein S2 -
  V8V52_RS10120 (V8V52_10120) tsf 1938971..1939858 (+) 888 WP_002088177.1 translation elongation factor Ts -
  V8V52_RS10125 (V8V52_10125) pyrH 1939925..1940647 (+) 723 WP_002014544.1 UMP kinase -
  V8V52_RS10130 (V8V52_10130) frr 1940651..1941208 (+) 558 WP_000531506.1 ribosome recycling factor -
  V8V52_RS10135 (V8V52_10135) - 1941294..1942070 (+) 777 WP_002014545.1 isoprenyl transferase -
  V8V52_RS10140 (V8V52_10140) cdsA 1942088..1942879 (+) 792 WP_002088171.1 phosphatidate cytidylyltransferase -
  V8V52_RS10145 (V8V52_10145) dxr 1942903..1944045 (+) 1143 WP_002014547.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  V8V52_RS10150 (V8V52_10150) rseP 1944063..1945319 (+) 1257 WP_002088169.1 RIP metalloprotease RseP -
  V8V52_RS10155 (V8V52_10155) - 1945429..1947129 (+) 1701 WP_078175371.1 proline--tRNA ligase -
  V8V52_RS10160 (V8V52_10160) - 1947254..1951555 (+) 4302 WP_088034484.1 PolC-type DNA polymerase III -
  V8V52_RS10165 (V8V52_10165) rimP 1951889..1952359 (+) 471 WP_002146103.1 ribosome maturation factor RimP -
  V8V52_RS10170 (V8V52_10170) nusA 1952377..1953483 (+) 1107 WP_002014554.1 transcription termination factor NusA -
  V8V52_RS10175 (V8V52_10175) - 1953495..1953767 (+) 273 WP_002088161.1 YlxR family protein -
  V8V52_RS10180 (V8V52_10180) - 1953768..1954079 (+) 312 WP_002111365.1 YlxQ family RNA-binding protein -
  V8V52_RS10185 (V8V52_10185) infB 1954084..1956150 (+) 2067 WP_002014558.1 translation initiation factor IF-2 -
  V8V52_RS10190 (V8V52_10190) - 1956147..1956428 (+) 282 WP_002088157.1 DUF503 family protein -
  V8V52_RS10195 (V8V52_10195) rbfA 1956444..1956800 (+) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  V8V52_RS10200 (V8V52_10200) truB 1956891..1957814 (+) 924 WP_002033681.1 tRNA pseudouridine(55) synthase TruB -
  V8V52_RS10205 (V8V52_10205) ribF 1957858..1958829 (+) 972 WP_002128800.1 bifunctional riboflavin kinase/FAD synthetase -
  V8V52_RS10210 (V8V52_10210) rpsO 1958930..1959199 (+) 270 WP_088034492.1 30S ribosomal protein S15 -
  V8V52_RS10215 (V8V52_10215) pnp 1959361..1961514 (+) 2154 WP_002033682.1 polyribonucleotide nucleotidyltransferase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.99 Da        Isoelectric Point: 4.7251

>NTDB_id=970926 V8V52_RS10110 WP_002014541.1 1937032..1937811(+) (codY) [Bacillus mycoides strain 4BM1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKHMLAERQFPEEYTQSLF
NVTETSSNLGVDSDYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=970926 V8V52_RS10110 WP_002014541.1 1937032..1937811(+) (codY) [Bacillus mycoides strain 4BM1]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAGAT
GTCTGACACAATGTGTGAAGTAATTGAAGCGAACGTGTTCGTTGTAAGTCGTCGCGGTAAATTATTAGGATATGCGATTC
ACCAACAAATCGAAAACGAACGTATGAAGCACATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACGCAAAGTTTATTC
AATGTTACAGAAACATCTTCAAATTTAGGTGTGGATAGTGACTACACAGCATTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACACTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATTCTTGCTGAATACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCGGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456


Multiple sequence alignment