Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACLF6N_RS13100 Genome accession   NZ_CP177279
Coordinates   2411881..2412264 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   -
Organism   Bacillus subtilis strain KFRI-P74     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2406881..2417264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLF6N_RS13060 (ACLF6N_13060) sinI 2407813..2407986 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLF6N_RS13065 (ACLF6N_13065) sinR 2408020..2408355 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLF6N_RS13070 (ACLF6N_13070) tasA 2408448..2409233 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  ACLF6N_RS13075 (ACLF6N_13075) sipW 2409298..2409870 (-) 573 WP_129134142.1 signal peptidase I SipW -
  ACLF6N_RS13080 (ACLF6N_13080) tapA 2409854..2410615 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ACLF6N_RS13085 (ACLF6N_13085) yqzG 2410887..2411213 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLF6N_RS13090 (ACLF6N_13090) spoIITA 2411255..2411434 (-) 180 WP_029726723.1 YqzE family protein -
  ACLF6N_RS13095 (ACLF6N_13095) comGG 2411506..2411880 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACLF6N_RS13100 (ACLF6N_13100) comGF 2411881..2412264 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ACLF6N_RS13105 (ACLF6N_13105) comGE 2412290..2412637 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  ACLF6N_RS13110 (ACLF6N_13110) comGD 2412621..2413052 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ACLF6N_RS13115 (ACLF6N_13115) comGC 2413042..2413338 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACLF6N_RS13120 (ACLF6N_13120) comGB 2413352..2414389 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  ACLF6N_RS13125 (ACLF6N_13125) comGA 2414376..2415446 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ACLF6N_RS13130 (ACLF6N_13130) - 2415658..2415855 (-) 198 WP_046160584.1 CBS domain-containing protein -
  ACLF6N_RS13135 (ACLF6N_13135) corA 2415857..2416810 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=970290 ACLF6N_RS13100 WP_046160582.1 2411881..2412264(-) (comGF) [Bacillus subtilis strain KFRI-P74]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=970290 ACLF6N_RS13100 WP_046160582.1 2411881..2412264(-) (comGF) [Bacillus subtilis strain KFRI-P74]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment