Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACJX3V_RS11935 Genome accession   NZ_CP176523
Coordinates   2464658..2464972 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MEPW12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2459658..2469972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJX3V_RS11890 sinI 2460341..2460514 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJX3V_RS11895 sinR 2460548..2460883 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJX3V_RS11900 tasA 2460931..2461716 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACJX3V_RS11905 sipW 2461780..2462364 (-) 585 WP_046559873.1 signal peptidase I SipW -
  ACJX3V_RS11910 tapA 2462336..2463007 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  ACJX3V_RS11915 - 2463266..2463595 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJX3V_RS11920 - 2463635..2463814 (-) 180 WP_003153093.1 YqzE family protein -
  ACJX3V_RS11925 comGG 2463871..2464248 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJX3V_RS11930 comGF 2464249..2464644 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACJX3V_RS11935 comGE 2464658..2464972 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJX3V_RS11940 comGD 2464956..2465393 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJX3V_RS11945 comGC 2465383..2465691 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJX3V_RS11950 comGB 2465696..2466733 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJX3V_RS11955 comGA 2466720..2467790 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJX3V_RS11960 - 2467982..2468932 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=967412 ACJX3V_RS11935 WP_015388003.1 2464658..2464972(-) (comGE) [Bacillus amyloliquefaciens strain MEPW12]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=967412 ACJX3V_RS11935 WP_015388003.1 2464658..2464972(-) (comGE) [Bacillus amyloliquefaciens strain MEPW12]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481