Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   WEB84_RS11420 Genome accession   NZ_CP147783
Coordinates   2121370..2122149 (+) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain Sterne-CLR2-13     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2082548..2156471 2121370..2122149 within 0


Gene organization within MGE regions


Location: 2082548..2156471
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WEB84_RS11230 (WEB84_11225) rsmB 2082706..2084040 (+) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  WEB84_RS11235 (WEB84_11230) rlmN 2084045..2085133 (+) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  WEB84_RS11240 (WEB84_11235) - 2085138..2085890 (+) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  WEB84_RS11245 (WEB84_11240) prkC 2085899..2087872 (+) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  WEB84_RS11250 (WEB84_11245) rsgA 2088141..2089022 (+) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  WEB84_RS11255 (WEB84_11250) rpe 2089025..2089669 (+) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  WEB84_RS11260 (WEB84_11255) - 2089769..2090449 (+) 681 WP_025388434.1 thiamine diphosphokinase -
  WEB84_RS11265 (WEB84_11260) spoVM 2090516..2090596 (+) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  WEB84_RS11270 (WEB84_11265) rpmB 2090669..2090857 (-) 189 WP_000124778.1 50S ribosomal protein L28 -
  WEB84_RS11275 (WEB84_11270) - 2091236..2091598 (+) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  WEB84_RS11280 (WEB84_11275) - 2091621..2093297 (+) 1677 WP_000027136.1 DAK2 domain-containing protein -
  WEB84_RS11285 (WEB84_11280) recG 2093587..2095635 (+) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  WEB84_RS11290 (WEB84_11285) fapR 2095724..2096317 (+) 594 WP_000747352.1 transcription factor FapR -
  WEB84_RS11295 (WEB84_11290) plsX 2096314..2097306 (+) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  WEB84_RS11300 (WEB84_11295) fabD 2097321..2098265 (+) 945 WP_000516958.1 ACP S-malonyltransferase -
  WEB84_RS11305 (WEB84_11300) fabG 2098265..2099005 (+) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  WEB84_RS11310 (WEB84_11305) acpP 2099075..2099308 (+) 234 WP_000786062.1 acyl carrier protein -
  WEB84_RS11315 (WEB84_11310) rncS 2099367..2100104 (+) 738 WP_001146873.1 ribonuclease III -
  WEB84_RS11320 (WEB84_11315) smc 2100251..2103820 (+) 3570 WP_000478985.1 chromosome segregation protein SMC -
  WEB84_RS11325 (WEB84_11320) ftsY 2103836..2104825 (+) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  WEB84_RS11330 (WEB84_11325) - 2104958..2105290 (+) 333 WP_000891062.1 putative DNA-binding protein -
  WEB84_RS11335 (WEB84_11330) ffh 2105303..2106652 (+) 1350 WP_000863456.1 signal recognition particle protein -
  WEB84_RS11340 (WEB84_11335) rpsP 2106753..2107025 (+) 273 WP_000268750.1 30S ribosomal protein S16 -
  WEB84_RS11345 (WEB84_11340) - 2107040..2107267 (+) 228 WP_000737398.1 KH domain-containing protein -
  WEB84_RS11350 (WEB84_11345) rimM 2107388..2107903 (+) 516 WP_000170269.1 ribosome maturation factor RimM -
  WEB84_RS11355 (WEB84_11350) trmD 2107903..2108637 (+) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  WEB84_RS11360 (WEB84_11355) rplS 2108784..2109128 (+) 345 WP_001186516.1 50S ribosomal protein L19 -
  WEB84_RS11365 (WEB84_11360) lepB 2109230..2109781 (+) 552 WP_000711857.1 signal peptidase I -
  WEB84_RS11370 (WEB84_11365) ylqF 2109802..2110692 (+) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  WEB84_RS11375 (WEB84_11370) rnhB 2110744..2111517 (+) 774 WP_001174712.1 ribonuclease HII -
  WEB84_RS11380 (WEB84_11375) sucC 2111711..2112871 (+) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  WEB84_RS11385 (WEB84_11380) sucD 2112892..2113794 (+) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  WEB84_RS11390 (WEB84_11385) dprA 2114116..2114750 (+) 635 Protein_2186 DNA-processing protein DprA -
  WEB84_RS11395 (WEB84_11390) topA 2114895..2116973 (+) 2079 WP_001286969.1 type I DNA topoisomerase -
  WEB84_RS11400 (WEB84_11395) trmFO 2117024..2118328 (+) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  WEB84_RS11405 (WEB84_11400) xerC 2118394..2119293 (+) 900 WP_001101226.1 tyrosine recombinase XerC -
  WEB84_RS11410 (WEB84_11405) hslV 2119336..2119878 (+) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  WEB84_RS11415 (WEB84_11410) hslU 2119901..2121292 (+) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  WEB84_RS11420 (WEB84_11415) codY 2121370..2122149 (+) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  WEB84_RS11425 (WEB84_11420) rpsB 2122499..2123200 (+) 702 WP_000111483.1 30S ribosomal protein S2 -
  WEB84_RS11430 (WEB84_11425) tsf 2123304..2124191 (+) 888 WP_001018581.1 translation elongation factor Ts -
  WEB84_RS11435 (WEB84_11430) pyrH 2124258..2124980 (+) 723 WP_000042663.1 UMP kinase -
  WEB84_RS11440 (WEB84_11435) frr 2124983..2125540 (+) 558 WP_000531498.1 ribosome recycling factor -
  WEB84_RS11445 (WEB84_11440) uppS 2125626..2126402 (+) 777 WP_000971303.1 isoprenyl transferase -
  WEB84_RS11450 (WEB84_11445) cdsA 2126420..2127211 (+) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  WEB84_RS11455 (WEB84_11450) dxr 2127235..2128377 (+) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  WEB84_RS11460 (WEB84_11455) rseP 2128394..2129650 (+) 1257 WP_001090228.1 RIP metalloprotease RseP -
  WEB84_RS11465 (WEB84_11460) - 2129760..2131460 (+) 1701 WP_000814312.1 proline--tRNA ligase -
  WEB84_RS11470 (WEB84_11465) - 2131585..2135886 (+) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  WEB84_RS11475 (WEB84_11470) rimP 2136219..2136689 (+) 471 WP_000359097.1 ribosome maturation factor RimP -
  WEB84_RS11480 (WEB84_11475) nusA 2136707..2137813 (+) 1107 WP_000102609.1 transcription termination factor NusA -
  WEB84_RS11485 (WEB84_11480) rnpM 2137825..2138097 (+) 273 WP_000071128.1 RNase P modulator RnpM -
  WEB84_RS11490 (WEB84_11485) - 2138098..2138409 (+) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  WEB84_RS11495 (WEB84_11490) infB 2138414..2140474 (+) 2061 WP_000036339.1 translation initiation factor IF-2 -
  WEB84_RS11500 (WEB84_11495) - 2140471..2140752 (+) 282 WP_000582364.1 DUF503 domain-containing protein -
  WEB84_RS11505 (WEB84_11500) rbfA 2140768..2141124 (+) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  WEB84_RS11510 (WEB84_11505) truB 2141211..2142134 (+) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  WEB84_RS11515 (WEB84_11510) ribF 2142178..2143149 (+) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  WEB84_RS11520 (WEB84_11515) rpsO 2143250..2143519 (+) 270 WP_001229392.1 30S ribosomal protein S15 -
  WEB84_RS11525 (WEB84_11520) pnp 2143680..2145818 (+) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  WEB84_RS11530 (WEB84_11525) - 2145970..2146869 (+) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  WEB84_RS11535 (WEB84_11530) - 2146956..2148197 (+) 1242 WP_000592993.1 pitrilysin family protein -
  WEB84_RS11540 (WEB84_11535) - 2148324..2148575 (+) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  WEB84_RS11545 (WEB84_11540) dpaA 2148850..2149752 (+) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  WEB84_RS11550 (WEB84_11545) dpaB 2149749..2150348 (+) 600 WP_001049484.1 dipicolinate synthase subunit B -
  WEB84_RS11555 (WEB84_11550) asd 2150499..2151545 (+) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  WEB84_RS11560 (WEB84_11555) dapG 2151569..2152801 (+) 1233 WP_000692470.1 aspartate kinase -
  WEB84_RS11565 (WEB84_11560) dapA 2152813..2153691 (+) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  WEB84_RS11570 (WEB84_11565) - 2154457..2156127 (+) 1671 WP_000823085.1 ribonuclease J -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=948623 WEB84_RS11420 WP_000421288.1 2121370..2122149(+) (codY) [Bacillus anthracis strain Sterne-CLR2-13]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=948623 WEB84_RS11420 WP_000421288.1 2121370..2122149(+) (codY) [Bacillus anthracis strain Sterne-CLR2-13]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459