Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACF0HW_RS06705 Genome accession   NZ_CP171208
Coordinates   1297760..1298074 (+) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens strain HN11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1292760..1303074
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF0HW_RS06680 - 1293795..1294745 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  ACF0HW_RS06685 comGA 1294942..1296012 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ACF0HW_RS06690 comGB 1295999..1297036 (+) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACF0HW_RS06695 comGC 1297083..1297349 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACF0HW_RS06700 comGD 1297339..1297776 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACF0HW_RS06705 comGE 1297760..1298074 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACF0HW_RS06710 comGF 1297983..1298483 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  ACF0HW_RS06715 comGG 1298484..1298861 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACF0HW_RS06720 - 1298918..1299097 (+) 180 WP_003153093.1 YqzE family protein -
  ACF0HW_RS06725 - 1299137..1299466 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACF0HW_RS06730 tapA 1299725..1300396 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  ACF0HW_RS06735 sipW 1300368..1300952 (+) 585 WP_012117977.1 signal peptidase I SipW -
  ACF0HW_RS06740 tasA 1301017..1301802 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACF0HW_RS06745 sinR 1301850..1302185 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACF0HW_RS06750 sinI 1302219..1302392 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=945673 ACF0HW_RS06705 WP_012117982.1 1297760..1298074(+) (comGE) [Bacillus amyloliquefaciens strain HN11]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=945673 ACF0HW_RS06705 WP_012117982.1 1297760..1298074(+) (comGE) [Bacillus amyloliquefaciens strain HN11]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471