Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   V6S68_RS18940 Genome accession   NZ_CP145726
Coordinates   3643296..3644075 (-) Length   259 a.a.
NCBI ID   WP_038414937.1    Uniprot ID   -
Organism   Bacillus anthracis strain CVCC40202     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3608974..3682898 3643296..3644075 within 0


Gene organization within MGE regions


Location: 3608974..3682898
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6S68_RS18790 (V6S68_18790) - 3609318..3610988 (-) 1671 WP_000823085.1 ribonuclease J -
  V6S68_RS18795 (V6S68_18795) dapA 3611754..3612632 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  V6S68_RS18800 (V6S68_18800) dapG 3612644..3613876 (-) 1233 WP_000692470.1 aspartate kinase -
  V6S68_RS18805 (V6S68_18805) asd 3613900..3614946 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  V6S68_RS18810 (V6S68_18810) dpaB 3615097..3615696 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  V6S68_RS18815 (V6S68_18815) dpaA 3615693..3616595 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  V6S68_RS18820 (V6S68_18820) - 3616870..3617121 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  V6S68_RS18825 (V6S68_18825) - 3617248..3618489 (-) 1242 WP_000592993.1 pitrilysin family protein -
  V6S68_RS18830 (V6S68_18830) - 3618576..3619475 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  V6S68_RS18835 (V6S68_18835) pnp 3619627..3621765 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  V6S68_RS18840 (V6S68_18840) rpsO 3621926..3622195 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  V6S68_RS18845 (V6S68_18845) ribF 3622296..3623267 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  V6S68_RS18850 (V6S68_18850) truB 3623311..3624234 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  V6S68_RS18855 (V6S68_18855) rbfA 3624321..3624677 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  V6S68_RS18860 (V6S68_18860) - 3624693..3624974 (-) 282 WP_000582364.1 DUF503 family protein -
  V6S68_RS18865 (V6S68_18865) infB 3624971..3627031 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  V6S68_RS18870 (V6S68_18870) - 3627036..3627347 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  V6S68_RS18875 (V6S68_18875) - 3627348..3627620 (-) 273 WP_000071128.1 YlxR family protein -
  V6S68_RS18880 (V6S68_18880) nusA 3627632..3628738 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  V6S68_RS18885 (V6S68_18885) rimP 3628756..3629226 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  V6S68_RS18890 (V6S68_18890) - 3629559..3633860 (-) 4302 WP_038414936.1 PolC-type DNA polymerase III -
  V6S68_RS18895 (V6S68_18895) - 3633985..3635685 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  V6S68_RS18900 (V6S68_18900) rseP 3635795..3637051 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  V6S68_RS18905 (V6S68_18905) dxr 3637068..3638210 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  V6S68_RS18910 (V6S68_18910) cdsA 3638234..3639025 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  V6S68_RS18915 (V6S68_18915) uppS 3639043..3639819 (-) 777 WP_000971303.1 isoprenyl transferase -
  V6S68_RS18920 (V6S68_18920) frr 3639905..3640462 (-) 558 WP_000531503.1 ribosome recycling factor -
  V6S68_RS18925 (V6S68_18925) pyrH 3640465..3641187 (-) 723 WP_000042663.1 UMP kinase -
  V6S68_RS18930 (V6S68_18930) tsf 3641254..3642141 (-) 888 WP_001018581.1 translation elongation factor Ts -
  V6S68_RS18935 (V6S68_18935) rpsB 3642245..3642946 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  V6S68_RS18940 (V6S68_18940) codY 3643296..3644075 (-) 780 WP_038414937.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  V6S68_RS18945 (V6S68_18945) hslU 3644153..3645544 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  V6S68_RS18950 (V6S68_18950) hslV 3645567..3646109 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  V6S68_RS18955 (V6S68_18955) xerC 3646152..3647051 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  V6S68_RS18960 (V6S68_18960) trmFO 3647117..3648421 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V6S68_RS18965 (V6S68_18965) topA 3648472..3650550 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  V6S68_RS18970 (V6S68_18970) dprA 3650695..3651563 (-) 869 Protein_3693 DNA-processing protein DprA -
  V6S68_RS18975 (V6S68_18975) sucD 3651651..3652553 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  V6S68_RS18980 (V6S68_18980) sucC 3652574..3653734 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  V6S68_RS18985 (V6S68_18985) rnhB 3653928..3654701 (-) 774 WP_001174712.1 ribonuclease HII -
  V6S68_RS18990 (V6S68_18990) ylqF 3654753..3655643 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  V6S68_RS18995 (V6S68_18995) lepB 3655664..3656215 (-) 552 WP_000711857.1 signal peptidase I -
  V6S68_RS19000 (V6S68_19000) rplS 3656317..3656661 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  V6S68_RS19005 (V6S68_19005) trmD 3656808..3657542 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V6S68_RS19010 (V6S68_19010) rimM 3657542..3658057 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  V6S68_RS19015 (V6S68_19015) - 3658178..3658405 (-) 228 WP_000737398.1 KH domain-containing protein -
  V6S68_RS19020 (V6S68_19020) rpsP 3658420..3658692 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  V6S68_RS19025 (V6S68_19025) ffh 3658793..3660142 (-) 1350 WP_000863456.1 signal recognition particle protein -
  V6S68_RS19030 (V6S68_19030) - 3660155..3660487 (-) 333 WP_000891062.1 putative DNA-binding protein -
  V6S68_RS19035 (V6S68_19035) ftsY 3660621..3661610 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  V6S68_RS19040 (V6S68_19040) smc 3661626..3665195 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  V6S68_RS19045 (V6S68_19045) rncS 3665342..3666079 (-) 738 WP_001146873.1 ribonuclease III -
  V6S68_RS19050 (V6S68_19050) acpP 3666138..3666371 (-) 234 WP_000786062.1 acyl carrier protein -
  V6S68_RS19055 (V6S68_19055) fabG 3666441..3667181 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  V6S68_RS19060 (V6S68_19060) fabD 3667181..3668125 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  V6S68_RS19065 (V6S68_19065) plsX 3668140..3669132 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  V6S68_RS19070 (V6S68_19070) fapR 3669129..3669722 (-) 594 WP_000747352.1 transcription factor FapR -
  V6S68_RS19075 (V6S68_19075) recG 3669811..3671859 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  V6S68_RS19080 (V6S68_19080) - 3672149..3673825 (-) 1677 WP_003158108.1 DAK2 domain-containing protein -
  V6S68_RS19085 (V6S68_19085) - 3673848..3674210 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  V6S68_RS19090 (V6S68_19090) rpmB 3674589..3674777 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  V6S68_RS19095 (V6S68_19095) spoVM 3674850..3674930 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  V6S68_RS19100 (V6S68_19100) - 3674997..3675677 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  V6S68_RS19105 (V6S68_19105) rpe 3675777..3676421 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  V6S68_RS19110 (V6S68_19110) rsgA 3676424..3677305 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  V6S68_RS19115 (V6S68_19115) prkC 3677574..3679547 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  V6S68_RS19120 (V6S68_19120) - 3679556..3680308 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  V6S68_RS19125 (V6S68_19125) rlmN 3680313..3681401 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  V6S68_RS19130 (V6S68_19130) rsmB 3681406..3682740 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28744.02 Da        Isoelectric Point: 4.7947

>NTDB_id=939777 V6S68_RS18940 WP_038414937.1 3643296..3644075(-) (codY) [Bacillus anthracis strain CVCC40202]
MELLAKARKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=939777 V6S68_RS18940 WP_038414937.1 3643296..3644075(-) (codY) [Bacillus anthracis strain CVCC40202]
ATGGAATTATTAGCAAAAGCAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCGCGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY helix-turn-helix domain (HTH_CodY)

(198-255)

CodY GAF-like domain (CodY)

(2-178)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

80.695

100

0.807
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456