Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   VXF94_RS18925 Genome accession   NZ_CP143956
Coordinates   3659433..3659699 (+) Length   88 a.a.
NCBI ID   WP_044051905.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain Fad 108     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3654433..3664699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VXF94_RS18905 (VXF94_18905) - 3654700..3656001 (-) 1302 WP_013352874.1 hemolysin family protein -
  VXF94_RS18910 (VXF94_18910) - 3656148..3657098 (+) 951 WP_013352873.1 magnesium transporter CorA family protein -
  VXF94_RS18915 (VXF94_18915) comGA 3657292..3658362 (+) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  VXF94_RS18920 (VXF94_18920) comGB 3658349..3659386 (+) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  VXF94_RS18925 (VXF94_18925) comGC 3659433..3659699 (+) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  VXF94_RS18930 (VXF94_18930) comGD 3659689..3660126 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  VXF94_RS18935 (VXF94_18935) comGE 3660110..3660424 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  VXF94_RS18940 (VXF94_18940) comGF 3660333..3660833 (+) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  VXF94_RS18945 (VXF94_18945) comGG 3660835..3661212 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  VXF94_RS18950 (VXF94_18950) - 3661266..3661445 (+) 180 WP_013352866.1 YqzE family protein -
  VXF94_RS18955 (VXF94_18955) - 3661486..3661815 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  VXF94_RS18960 (VXF94_18960) tapA 3662073..3662744 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  VXF94_RS18965 (VXF94_18965) sipW 3662716..3663300 (+) 585 WP_013352863.1 signal peptidase I SipW -
  VXF94_RS18970 (VXF94_18970) tasA 3663365..3664150 (+) 786 WP_013352862.1 biofilm matrix protein TasA -
  VXF94_RS18975 (VXF94_18975) sinR 3664198..3664533 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9749.41 Da        Isoelectric Point: 6.7057

>NTDB_id=932239 VXF94_RS18925 WP_044051905.1 3659433..3659699(+) (comGC) [Bacillus amyloliquefaciens strain Fad 108]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMTDLQSEGYIKKNTACPNGKQILIK
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=932239 VXF94_RS18925 WP_044051905.1 3659433..3659699(+) (comGC) [Bacillus amyloliquefaciens strain Fad 108]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACGATTCCTAACGTAACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTTCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGAAAAATGC
CGGATATGACCGACTTACAATCAGAGGGATATATCAAAAAGAATACAGCCTGCCCGAATGGAAAACAGATTTTAATAAAG
GGCGGGGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602