Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACB332_RS00675 Genome accession   NZ_CP167016
Coordinates   104616..104900 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain Isolate 10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99616..109900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB332_RS00650 (ACB332_00650) - 101562..101927 (+) 366 WP_002986560.1 DUF1033 family protein -
  ACB332_RS00655 (ACB332_00655) comGA 102020..102958 (+) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  ACB332_RS00660 (ACB332_00660) comGB 102894..103928 (+) 1035 WP_228631569.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACB332_RS00665 (ACB332_00665) comGC 103930..104256 (+) 327 WP_011528161.1 competence type IV pilus major pilin ComGC Machinery gene
  ACB332_RS00670 (ACB332_00670) comGD 104231..104659 (+) 429 WP_076639399.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACB332_RS00675 (ACB332_00675) comGE 104616..104900 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACB332_RS00680 (ACB332_00680) comGF 104893..105327 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACB332_RS00685 (ACB332_00685) comGG 105311..105637 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  ACB332_RS00690 (ACB332_00690) comGH 105735..106688 (+) 954 WP_129322573.1 class I SAM-dependent methyltransferase Machinery gene
  ACB332_RS00695 (ACB332_00695) - 106747..107943 (+) 1197 WP_020904834.1 acetate kinase -
  ACB332_RS00700 (ACB332_00700) - 108130..108438 (+) 309 Protein_89 hypothetical protein -
  ACB332_RS00705 (ACB332_00705) proC 108521..109291 (-) 771 WP_076639397.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=930971 ACB332_RS00675 WP_002987779.1 104616..104900(+) (comGE) [Streptococcus pyogenes strain Isolate 10]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=930971 ACB332_RS00675 WP_002987779.1 104616..104900(+) (comGE) [Streptococcus pyogenes strain Isolate 10]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383