Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACB359_RS00675 Genome accession   NZ_CP167013
Coordinates   104263..104547 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain Isolate 16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99263..109547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB359_RS00650 (ACB359_00650) - 101209..101574 (+) 366 WP_002986560.1 DUF1033 family protein -
  ACB359_RS00655 (ACB359_00655) comGA 101667..102605 (+) 939 WP_020904831.1 competence type IV pilus ATPase ComGA Machinery gene
  ACB359_RS00660 (ACB359_00660) comGB 102541..103575 (+) 1035 WP_226316548.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACB359_RS00665 (ACB359_00665) comGC 103577..103903 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ACB359_RS00670 (ACB359_00670) comGD 103878..104306 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACB359_RS00675 (ACB359_00675) comGE 104263..104547 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACB359_RS00680 (ACB359_00680) comGF 104540..104974 (+) 435 WP_020904833.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACB359_RS00685 (ACB359_00685) comGG 104958..105284 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  ACB359_RS00690 (ACB359_00690) comGH 105382..106335 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  ACB359_RS00695 (ACB359_00695) - 106394..107590 (+) 1197 WP_020904834.1 acetate kinase -
  ACB359_RS00700 (ACB359_00700) - 107777..108085 (+) 309 Protein_89 hypothetical protein -
  ACB359_RS00705 (ACB359_00705) proC 108168..108938 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=930786 ACB359_RS00675 WP_011284422.1 104263..104547(+) (comGE) [Streptococcus pyogenes strain Isolate 16]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=930786 ACB359_RS00675 WP_011284422.1 104263..104547(+) (comGE) [Streptococcus pyogenes strain Isolate 16]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383