Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACB355_RS00670 Genome accession   NZ_CP167011
Coordinates   104628..104912 (+) Length   94 a.a.
NCBI ID   WP_032465969.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain Isolate 18     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99628..109912
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB355_RS00645 (ACB355_00645) - 101573..101938 (+) 366 WP_002986560.1 DUF1033 family protein -
  ACB355_RS00650 (ACB355_00650) comGA 102031..102970 (+) 940 Protein_79 competence type IV pilus ATPase ComGA -
  ACB355_RS00655 (ACB355_00655) comGB 102906..103940 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACB355_RS00660 (ACB355_00660) comGC 103942..104268 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ACB355_RS00665 (ACB355_00665) comGD 104243..104671 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACB355_RS00670 (ACB355_00670) comGE 104628..104912 (+) 285 WP_032465969.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACB355_RS00675 (ACB355_00675) comGF 104905..105339 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACB355_RS00680 (ACB355_00680) comGG 105323..105649 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ACB355_RS00685 (ACB355_00685) comGH 105747..106700 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  ACB355_RS00690 (ACB355_00690) - 106759..107955 (+) 1197 WP_023078999.1 acetate kinase -
  ACB355_RS00695 (ACB355_00695) - 108141..108449 (+) 309 WP_030126458.1 hypothetical protein -
  ACB355_RS00700 (ACB355_00700) proC 108532..109302 (-) 771 WP_023078993.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10660.57 Da        Isoelectric Point: 8.9043

>NTDB_id=930597 ACB355_RS00670 WP_032465969.1 104628..104912(+) (comGE) [Streptococcus pyogenes strain Isolate 18]
MGIIKKQVKAYIALESMIATGTLFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=930597 ACB355_RS00670 WP_032465969.1 104628..104912(+) (comGE) [Streptococcus pyogenes strain Isolate 18]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCACCCTCTTTAGTATTGT
CATTCTTGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383