Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACB350_RS00685 Genome accession   NZ_CP166999
Coordinates   107972..108256 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain Isolate 34     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 102972..113256
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB350_RS00660 (ACB350_00660) - 104917..105282 (+) 366 WP_002986560.1 DUF1033 family protein -
  ACB350_RS00665 (ACB350_00665) comGA 105376..106314 (+) 939 WP_030127399.1 competence type IV pilus ATPase ComGA Machinery gene
  ACB350_RS00670 (ACB350_00670) comGB 106250..107284 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACB350_RS00675 (ACB350_00675) comGC 107286..107612 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ACB350_RS00680 (ACB350_00680) comGD 107587..108015 (+) 429 WP_030127397.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACB350_RS00685 (ACB350_00685) comGE 107972..108256 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACB350_RS00690 (ACB350_00690) comGF 108249..108683 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACB350_RS00695 (ACB350_00695) comGG 108667..108993 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  ACB350_RS00700 (ACB350_00700) comGH 109091..110044 (+) 954 WP_030127396.1 class I SAM-dependent methyltransferase Machinery gene
  ACB350_RS00705 (ACB350_00705) - 110103..111299 (+) 1197 WP_011888536.1 acetate kinase -
  ACB350_RS00710 (ACB350_00710) - 111486..111794 (+) 309 WP_030126458.1 hypothetical protein -
  ACB350_RS00715 (ACB350_00715) proC 111877..112647 (-) 771 WP_030127395.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=929454 ACB350_RS00685 WP_002987779.1 107972..108256(+) (comGE) [Streptococcus pyogenes strain Isolate 34]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=929454 ACB350_RS00685 WP_002987779.1 107972..108256(+) (comGE) [Streptococcus pyogenes strain Isolate 34]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383