Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB3239_RS13315 Genome accession   NZ_CP166831
Coordinates   2557620..2558003 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   -
Organism   Bacillus subtilis strain TE3T-UV25     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2552620..2563003
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3239_RS13275 (AB3239_13275) sinI 2553554..2553727 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  AB3239_RS13280 (AB3239_13280) sinR 2553761..2554096 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB3239_RS13285 (AB3239_13285) tasA 2554188..2554973 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  AB3239_RS13290 (AB3239_13290) sipW 2555038..2555610 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AB3239_RS13295 (AB3239_13295) tapA 2555594..2556355 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  AB3239_RS13300 (AB3239_13300) yqzG 2556626..2556952 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  AB3239_RS13305 (AB3239_13305) spoIITA 2556994..2557173 (-) 180 WP_014480252.1 YqzE family protein -
  AB3239_RS13310 (AB3239_13310) comGG 2557245..2557619 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  AB3239_RS13315 (AB3239_13315) comGF 2557620..2558003 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  AB3239_RS13320 (AB3239_13320) comGE 2558029..2558376 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  AB3239_RS13325 (AB3239_13325) comGD 2558360..2558791 (-) 432 WP_038829732.1 comG operon protein ComGD Machinery gene
  AB3239_RS13330 (AB3239_13330) comGC 2558781..2559077 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  AB3239_RS13335 (AB3239_13335) comGB 2559091..2560128 (-) 1038 WP_038829731.1 comG operon protein ComGB Machinery gene
  AB3239_RS13340 (AB3239_13340) comGA 2560115..2561185 (-) 1071 WP_032726161.1 competence protein ComGA Machinery gene
  AB3239_RS13345 (AB3239_13345) - 2561397..2561594 (-) 198 WP_032726162.1 hypothetical protein -
  AB3239_RS13350 (AB3239_13350) corA 2561596..2562549 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=929102 AB3239_RS13315 WP_032726158.1 2557620..2558003(-) (comGF) [Bacillus subtilis strain TE3T-UV25]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=929102 AB3239_RS13315 WP_032726158.1 2557620..2558003(-) (comGF) [Bacillus subtilis strain TE3T-UV25]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCATATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992